CAZyme Information: MGYG000000424_00667

Basic Information

• Species: CAG-353 sp900768995
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; CAG-353; CAG-353 sp900768995
• CAZyme ID: MGYG000000424_00667
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
342	MGYG000000424_4|CGC1	39093.63	4.6193

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000424	2854163	MAG	Sweden	Europe

• Gene Location: Start: 62454; End: 63482 Strand: +

Full Sequence      

MLKKIAAVIIAAITTASSAACTAHEKLNEKYPDTSVSQSAEPKLSNPDADKNAQALYSYI
CETYKHGIISGQQESTWMGSEQYEFDYIYDKTGKYPAIRGLDYMNDDFDGVNRRAEEWFN
KGGIVTICWHCGSDFSHSWDECMKTEIDDWDKALTEGTEEYKALIAGMDKGAKALSKLRD
KGIPVLWRPFHELDGGWFWWSKGGAENFKKLWKIMYDRYTNYWELDNLIWVFGYSGNGRN
YDKWYPGDEYVDIAGADSYNDGANASLYKKVTAVVGNDMPVAFHECGRIPTPEQLKKGGA
DWVWFMTWHTSYITDNNDTADLKAIYNDDYVITLDELPKIYQ

Enzyme Prediction     

No EC number prediction in MGYG000000424_00667.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	45	336	7.7e-96	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.25e-56	46	336	2	311	Glycosyl hydrolase family 26.
COG4124	ManB2	9.69e-18	145	261	147	258	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADU20874.1	8.19e-134	13	341	137	463
BCN30282.1	4.18e-117	43	339	5	298
AWB26443.1	1.15e-94	35	340	39	339
AJP70762.1	2.23e-84	42	337	20	318
QTI90542.1	2.21e-81	47	340	41	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZM8_A	5.71e-63	42	337	143	447	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HF2_A	2.27e-55	43	314	44	320	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6Q75_A	6.01e-53	46	337	25	327	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
3WDQ_A	1.60e-51	24	338	18	353	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6HPF_A	2.26e-50	46	337	8	310	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	4.53e-59	44	337	174	476	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
Q5AWB7	2.70e-53	43	337	27	350	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P49425	1.41e-50	43	338	145	458	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
P55298	6.14e-44	36	338	148	460	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1
P55297	6.30e-44	36	338	150	462	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000476	0.282116	0.717049	0.000121	0.000127	0.000106

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000424_00667.