CAZyme Information: MGYG000000426_00013

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; UBA5026
• CAZyme ID: MGYG000000426_00013
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
976		107932.22	7.4205

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000426	1083370	MAG	Sweden	Europe

• Gene Location: Start: 10785; End: 13715 Strand: +

Full Sequence      

MKKFINENKDNIIIAVVSIIAFILGCLSIGKIAILIVGIIDILLFVPSWIKKYKGDFMKK
KAHPKAKNTNKKVSKTNKSKKKKILKIVLAIFLGLCVLGIIGVACLIMYIVAKAPNFNPD
NLYKQESSVFYDINGDVYATLGNEKRENVKYSDLPEVLINAIVATEDSRFFEHNGVDWAR
FIKATLLQLVGKSEAGGASTITMQVSKNDVTQDKTATGIKGILRKFTDVYMSLEQIEKHY
TKEEIMEFYVNSYYLGGGASGVEQACQTYFGKSVSEINLAEASIIAGLFQLPGAYDPLVH
PEATEVRRKTVLNLMVRHGYITEEEKNAALAISVEDLLVSDAKSSADNDSNLSFINTVTA
QLIKEFGEKGNPYTTSMEVWTTMDPDKQDHINKIMSGDTWKWENDNVTAGIAVIDVKTGA
ISAVGGGRNLVARGTNTALDIKKQIGSTSKPIYDYAPGIEYENWSTYEPFTDEKYAYSDG
TEINNWDVKYEGFLTARTALAHSRNVSALKAFQANKNSNILKFVKGLGLHPEESNGFVHE
AHAIGGYNGEYPIAMAAAYSSFANGGYYVEPYSYTKVTFRQSGETVEKKVEKSRAMSEET
AYMVYDMLISSGKYGLGNQYNVNGATYGAKTGTSNFDDKTKKLLGLPDNAINDYWVSGVS
PDYAISVWYGYIRNYQRKDPNKDNYCKDCYNTINEIYHRKLFQAVAKGFFKKGSSISMPS
GVVKVEVENETYPAKLPSAYTPDNMKVTELFKKGTEPTDVSDRYAKLDDVTNLSSKVNGN
EVTLSWTGIKTPNAIDEESLNSFFSKFWKNTSIPLKSRKEYNNKYIGNIVYKVYAVLSDG
QLQLVNSTSDNSITFSINTSSSDTYIVKTSYSIFTSNMSDGVKVSIDKAGVTDKTEATLI
GDNPYVVTSTFSEPGVKVIQNDVDITNSCTITTSYKNSANVDVQVSSINTTGTYTATYNI
VCGTFSDTLTRKIVIP

Enzyme Prediction     

No EC number prediction in MGYG000000426_00013.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	135	316	6.2e-53	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0744	MrcB	8.92e-136	89	671	17	571	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.68e-90	92	764	8	771	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	2.98e-67	134	316	1	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG4953	PbpC	4.45e-55	97	670	7	534	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	3.44e-43	131	589	51	607	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYA76804.1	7.04e-148	91	853	37	757
APH04640.1	1.12e-147	86	848	34	742
QHA36698.1	2.98e-145	52	849	4	786
AWI12666.1	3.88e-145	51	893	3	783
AIE60509.1	1.62e-143	74	786	17	720

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DWK_A	2.27e-90	131	731	11	619	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	1.21e-86	113	673	2	568	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]
3ZG8_B	3.13e-46	235	671	2	432	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3ZG7_B	2.47e-42	235	671	2	432	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]
5U2G_A	1.89e-40	125	577	19	555	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39793	2.66e-126	75	786	24	727	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1
Q00573	3.23e-89	77	671	2	600	Penicillin-binding protein 1A (Fragment) OS=Streptococcus oralis OX=1303 GN=ponA PE=3 SV=1
Q04707	5.78e-87	83	671	8	599	Penicillin-binding protein 1A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=ponA PE=1 SV=2
Q8DR59	2.12e-86	83	671	8	599	Penicillin-binding protein 1A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pbpA PE=1 SV=1
P38050	1.16e-63	78	741	3	630	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999499	0.000464	0.000026	0.000002	0.000001	0.000027

TMHMM  Annotations     

start	end
12	29
33	50
88	110