CAZyme Information: MGYG000000428_00966

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-552; UMGS1795
• CAZyme ID: MGYG000000428_00966
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
176	MGYG000000428_33|CGC1	20146.38	8.8948

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000428	1789472	MAG	Sweden	Europe

• Gene Location: Start: 6825; End: 7355 Strand: -

Full Sequence      

MPVKIRIIALIAAIFAFLFAFSSLVVCVCYPVRYKSEITRACAEYELDESLVYAVIVCES
GFDKNARSSRGAVGLMQLMPQTAEWCAKMAREEFSAEKLTEPGYNVSLGCRYLKYLIDKF
KSEKWAVAAFNAGEGNVKNWLDTDKKIRFPETEAYVNNVFAARRIYKYRLNKNENR

Enzyme Prediction     

No EC number prediction in MGYG000000428_00966.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	50	164	2.7e-27	0.7777777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	9.89e-57	31	165	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	5.97e-48	30	169	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	9.27e-37	49	162	1	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	9.38e-30	28	176	133	293	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	2.46e-28	45	146	8	108	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZT90270.1	9.58e-33	4	167	4	175
AGF54660.1	2.56e-32	30	173	34	188
AIS52076.1	2.63e-32	30	174	31	186
ADV80073.1	5.25e-32	30	168	31	180
ABY95122.1	7.84e-32	30	168	46	195

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	4.66e-19	30	171	445	597	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	4.71e-19	30	171	474	626	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FC4_A	1.18e-18	30	171	446	598	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FCQ_A	1.18e-18	30	171	445	597	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
1QSA_A	1.88e-17	30	168	449	600	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	7.32e-18	36	162	62	178	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P39434	2.23e-17	30	174	476	633	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O64046	4.75e-17	30	161	1418	1539	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	4.75e-17	30	161	1418	1539	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
P0AGC4	1.04e-16	30	168	476	627	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.810153	0.135209	0.051272	0.000692	0.000380	0.002290

TMHMM  Annotations     

start	end
10	32