CAZyme Information: MGYG000000429_00509

Basic Information

• Species: UBA7597 sp900542935
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA7597; UBA7597 sp900542935
• CAZyme ID: MGYG000000429_00509
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
551		61933.75	6.7422

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000429	1972857	MAG	Sweden	Europe

• Gene Location: Start: 147363; End: 149018 Strand: +

Full Sequence      

MSETKSGTTKNARRATLVKTNRTIARAEKNAQAVVRAKAAKNEGEKEMPKVKIITDEKDD
LKTAAKEEAAVTIKPKRKILFAASECTPFIATGGLAEVIGSLSKSLAQDEEYDVRVVLPL
YSDIRGDYRQRFTYLGNINVPLGWRNQYCGIFSYEESGVTFYFLDNEYYFRRGGCYGYYD
DGERFAFFSRAVMEILGFLQFYPDVLHCHDWQAALAAIYLKTIYCHRREYSLIRAVFTIH
NIEYQGKYSLDVLEDLFGISNDYRYLLEFDGCANLMKAAIECSETFTTVSPTYAEEIKRA
EYAHGLQGEVERNAFKLRGILNGIDVKSYDPATDPALFAPYSAENPAGKEVCKAELQKML
GLPVRADVPVVAMISRLVAHKGLDLVRAAIEELLADDVQFVLLGTGDSEYESYFKDLANR
YKGKAVSIIAFNGDLSRKIYSGADIFLMPSKSEPCGLSQMIASRYLTVPVVRETGGLYDS
IKPYGAGGNGFTFAAYNAGDMLYVLREAVLLYKNKPEWQKLMIKAGTTDFSWQRSAEEYK
KLYTDTLALLK

Enzyme Prediction     

No EC number prediction in MGYG000000429_00509.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	78	544	4.8e-169	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	78	545	1	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	0.0	78	548	2	465	glycogen synthase GlgA.
COG0297	GlgA	0.0	78	543	2	475	Glycogen synthase [Carbohydrate transport and metabolism].
TIGR02095	glgA	0.0	78	544	2	471	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK14099	PRK14099	1.47e-101	78	548	5	481	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEY34691.1	3.49e-170	78	547	2	472
QIA32150.1	9.84e-168	79	543	3	472
ANU40325.1	1.97e-167	79	543	3	472
QQR06905.1	1.97e-167	79	543	3	472
QNO18264.1	5.60e-166	78	547	2	472

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HLN_A	4.02e-82	74	543	122	622	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]
3D1J_A	4.55e-78	78	543	2	473	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	7.89e-78	78	543	2	473	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	6.01e-77	78	543	2	473	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
6GNE_A	1.09e-76	79	548	12	499	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4J4I4	2.39e-154	78	547	2	475	Glycogen synthase OS=Desulfotomaculum reducens (strain MI-1) OX=349161 GN=glgA PE=3 SV=1
A4IS20	2.60e-152	78	543	2	471	Glycogen synthase OS=Geobacillus thermodenitrificans (strain NG80-2) OX=420246 GN=glgA PE=3 SV=1
O08328	1.04e-151	78	543	2	471	Glycogen synthase OS=Geobacillus stearothermophilus OX=1422 GN=glgA PE=3 SV=1
B9J2G5	1.30e-147	79	543	3	471	Glycogen synthase OS=Bacillus cereus (strain Q1) OX=361100 GN=glgA PE=3 SV=1
Q6HC18	1.84e-147	79	543	3	471	Glycogen synthase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) OX=281309 GN=glgA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000429_00509.