CAZyme Information: MGYG000000429_00667

Basic Information

• Species: UBA7597 sp900542935
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA7597; UBA7597 sp900542935
• CAZyme ID: MGYG000000429_00667
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
715		80372.45	4.8712

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000429	1972857	MAG	Sweden	Europe

• Gene Location: Start: 141860; End: 144007 Strand: -

Full Sequence      

MWIKRESLTENDGLPVFVKSFNAEKGLKNCSLKITATGIFDVNINGYEIPDRFMPGWSNY
FRHIDLCRYDITERIIPGGKNTLRITVANGWYSGKLGYGNKTNVFGDEKRLFAELTLTYD
DGHTDTIVSDESWKIAGSDVIAADFFDGETIDARRRGQAGKIVGNAVITDFGVPFQVYSR
EPVRVTESISPQVIFSDENTVRYDFGCNFAGVIRVTAQGKRGGKIVAKYGETTDENGEVY
TANLRRAKCTDEFILSGGEDTFEPKFTYHGFRYAELKKSAGTEIVSAEGLAISQDIEYYG
SFECSDEVMNGVYRMALRGQKSNFISIPTDCPQRDERLGWTGDAEVFCNSAMFNADCDLF
FKNYLSLVREDALPDGKIPSIVPFYVGISDNTAGVPGWGDCITVIPYFHFLHYRDLSAAE
DNLPAAEKWIGYYLAKSENYLTKITNNFGDWLSVNGDTDPDVINQCFFGYSALLTAKLCE
ILKKDEKRDTYTEIYENCRRAFRENYYKDGRISCDTQTAYAFAYVAGYLSKEETLARLPK
IIRENGGGLTTGFIGSRFILPALCDIGETELAYEIISRTEYPSWGYMLKNGATTVWERWN
GYTKEHGFEDPEMNSFNHYSLGSCVEWLYSYVLGIKLFPEQEKVVISPSFGKKLAFARGG
TRVKGGKIFVKWRRENNAVILEVKADEGVNYEICVPDGVQSAVKNGNDTVATIYL

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	197	693	1.5e-147	0.9861111111111112
CBM67	2	156	2.3e-18	0.8238636363636364

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.20e-114	300	632	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	7.95e-33	32	155	8	132	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	2.14e-25	197	281	4	89	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	9.56e-05	643	704	11	72	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNF26773.1	1.45e-153	19	696	149	866
AXY78413.1	3.62e-149	15	712	153	874
ASV74703.1	1.41e-148	13	698	335	1032
SDT48222.1	1.34e-146	15	711	148	872
ASU32381.1	1.21e-145	15	713	153	879

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	3.90e-125	25	696	314	995	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	5.61e-100	17	635	134	778	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	6.30e-99	15	710	177	913	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3CIH_A	1.63e-13	126	691	125	691	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	1.18e-125	19	708	179	891	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	1.63e-124	25	696	314	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	3.16e-117	15	696	170	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	2.55e-57	17	706	187	918	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000429_00667.