CAZyme Information: MGYG000000429_00816

Basic Information

• Species: UBA7597 sp900542935
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA7597; UBA7597 sp900542935
• CAZyme ID: MGYG000000429_00816
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
427	MGYG000000429_5|CGC2	48770.96	6.253

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000429	1972857	MAG	Sweden	Europe

• Gene Location: Start: 131350; End: 132633 Strand: +

Full Sequence      

MAKNFGLSYKQLDFLNWEFGVFFHFGIRSFYRGHKDWDGKDMPLSAFLPEKFDAFDWTET
ARKAGAKYVIFTAKHHDGFALWQSAYTEYGVKNTPWKGGKGDAVKEFAEAARKSGLKVGL
YYSPAQWGKTAVKFENGKEYDDYFINQITELLTNYGKIDYLWFDGCGSENHEYDKERIVK
EIYRLQPHILTFSGAEWHPDVRWIGNEAGYASKFNPLTVKSGYFSELATQADVFPEDTCI
PAECDCKIRDTWFYDDNENTLKSADELFGMYESSVGGGSNFLLNVSPDDRGLLPEADKKR
LLELGEKIAQYSSPVSFSAPYKDGENAYSIDAPCRGKPWEKCRENSELVNRIVLREDLSK
GQNAQLFEIYAYPYVYQNRKLLVYKGATIGHKAICHIPVMRASKFTIEIASESGKTAISE
MKAYFVK

Enzyme Prediction     

No EC number prediction in MGYG000000429_00816.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	13	311	3.9e-78	0.8554913294797688

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	3.42e-63	11	411	15	417	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam01120	Alpha_L_fucos	7.11e-52	19	306	27	326	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	7.66e-44	19	306	28	328	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS95058.1	1.76e-134	10	425	10	415
BBH22425.1	1.89e-117	10	426	12	415
ASK62228.1	3.32e-116	10	424	11	409
QHT59657.1	8.41e-115	10	425	22	427
ASN07285.1	2.85e-114	10	426	8	401

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZRX_A	2.16e-72	10	427	35	461	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
3UES_A	2.64e-62	8	423	20	475	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3MO4_A	1.49e-61	8	423	22	477	Thecrystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3MO4_B The crystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3UET_A	2.95e-60	8	423	20	475	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UET_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3EYP_A	5.22e-58	8	297	11	308	Crystalstructure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],3EYP_B Crystal structure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],4OUE_A Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OUE_B Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_A Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_B Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7XUR3	6.09e-63	8	419	41	471	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
Q8GW72	1.04e-60	15	306	43	338	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
P10901	1.24e-21	18	330	41	375	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1
Q99KR8	2.28e-16	47	341	101	387	Plasma alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca2 PE=1 SV=1
Q6AYS4	3.03e-16	47	341	99	385	Plasma alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999974	0.000053	0.000005	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000429_00816.