CAZyme Information: MGYG000000429_01353

Basic Information

• Species: UBA7597 sp900542935
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA7597; UBA7597 sp900542935
• CAZyme ID: MGYG000000429_01353
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
505		57050.86	4.7572

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000429	1972857	MAG	Sweden	Europe

• Gene Location: Start: 102867; End: 104384 Strand: +

Full Sequence      

MKLTIDYLEEEHFFGGTVNDGIFMPYSAGFSRDLRVWHAGNQASSFLLSDRGRAVYSEKP
FKYEFFSDHIEVEGDDILVERNGDTLKSAYTAMCKKFAPAGKNTIPPEIMFSSPQYNTWI
EMEWDCTQDKVLEYADRILSHGYPAGVLMIDDCWCRAYGDWKFNAASFPDPKAMIDKLHR
SGFKVMLWCCPFVSPDTAVFRELEKLGALVKKSDGTTAISHWWNGYSAVLDLTNPAATAW
FEKQASALMDDFGIDGFKFDAADPEYYNDDFVFFDGSDRSMQAKIWAEIGAKYSFNELRA
GFNAGWLPVVNRLRDKNHSWNDDGLNTLVPDGIAMGLCGYQYLCPDMIGGGMVPDFHRDG
FVFDEELFVRYCQVAALFPMMQFSRAPWKVLSEKNQKICLDAVGLHGDLAEYIIQTAKRC
AASGEPMIRNLEYAYPHSGYAMVNDEFLLGEDILVAPQLKKGMSTRQVVIPDGIWEDPAG
NSYRKGIYPVDTPITVIPVFKRIGK

Enzyme Prediction     

No EC number prediction in MGYG000000429_01353.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	100	504	6.1e-80	0.9461358313817331

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06592	GH31_NET37	2.37e-154	112	475	1	364	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG1501	YicI	4.08e-62	1	504	143	667	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
pfam01055	Glyco_hydro_31	2.94e-57	127	500	41	435	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
PRK10426	PRK10426	5.26e-41	129	504	221	620	alpha-glucosidase; Provisional
cd06597	GH31_transferase_CtsY	1.39e-39	101	383	1	287	CtsY (cyclic tetrasaccharide-synthesizing enzyme Y)-like. CtsY is a bacterial 3-alpha-isomaltosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsZ. CtsY and CtsZ both have a glycosyl hydrolase family 31 (GH31) catalytic domain; CtsZ belongs to a different subfamily. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEI41761.1	6.30e-164	2	502	5	506
QJD86405.1	1.45e-163	2	501	5	509
QHT59803.1	1.55e-162	3	502	6	508
BBI31333.1	5.37e-162	2	502	8	513
AIQ34466.1	2.27e-161	2	502	5	505

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F7S_A	8.64e-32	123	504	303	730	Cycloalternan-degradingenzyme from Trueperella pyogenes [Trueperella pyogenes],5F7S_B Cycloalternan-degrading enzyme from Trueperella pyogenes [Trueperella pyogenes],5I0E_B Cycloalternan-degrading enzyme from Trueperella pyogenes in complex with isomaltose [Trueperella pyogenes],5I0F_B Cycloalternan-degrading enzyme from Trueperella pyogenes in complex with covalent intermediate [Trueperella pyogenes]
5I0G_B	9.14e-31	123	504	303	730	Cycloalternan-degradingenzyme from Trueperella pyogenes in complex with cycloalternan [Trueperella pyogenes]
5F7C_A	3.13e-30	116	502	312	710	Crystalstructure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_B Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_C Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_D Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
5X3I_A	4.48e-27	167	505	371	734	ChainA, Glycoside hydrolase family 31 [Kribbella flavida DSM 17836],5X3I_B Chain B, Glycoside hydrolase family 31 [Kribbella flavida DSM 17836],5X3J_A Chain A, Glycoside hydrolase family 31 [Kribbella flavida DSM 17836],5X3J_B Chain B, Glycoside hydrolase family 31 [Kribbella flavida DSM 17836],5X3K_A Chain A, Glycoside hydrolase family 31 [Kribbella flavida DSM 17836],5X3K_B Chain B, Glycoside hydrolase family 31 [Kribbella flavida DSM 17836]
5AED_A	1.29e-26	156	502	301	663	Abacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AED_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEG_A A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5AEG_B A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5OHT_A A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12],5OHT_B A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6NSJ0	8.96e-62	83	491	286	703	Myogenesis-regulating glycosidase OS=Homo sapiens OX=9606 GN=MYORG PE=1 SV=2
Q69ZQ1	9.04e-61	83	491	285	705	Myogenesis-regulating glycosidase OS=Mus musculus OX=10090 GN=Myorg PE=1 SV=2
D2PPM7	7.42e-27	167	505	351	714	1,3-alpha-isomaltosidase OS=Kribbella flavida (strain DSM 17836 / JCM 10339 / NBRC 14399) OX=479435 GN=Kfla_1895 PE=1 SV=1
P32138	6.96e-26	156	502	301	663	Sulfoquinovosidase OS=Escherichia coli (strain K12) OX=83333 GN=yihQ PE=1 SV=3
P31434	6.20e-25	101	475	259	635	Alpha-xylosidase OS=Escherichia coli (strain K12) OX=83333 GN=yicI PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000429_01353.