CAZyme Information: MGYG000000432_01385

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-269
• CAZyme ID: MGYG000000432_01385
• CAZy Family: GH18
• CAZyme Description: Spore germination protein YaaH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328		37507.31	4.4505

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000432	1590144	MAG	Sweden	Europe

• Gene Location: Start: 691; End: 1677 Strand: +

Full Sequence      

MQESKQIEGKVNLVWDYYSEVATAPDRTGVTMDGVNVVSPAFFHLNSKGELTENVGQAGQ
EYIEWAHSNGYKVWPMVQNAGNGMINVTSDIMNDYNKRQELINEIVVACVRYKLDGINID
FENMKQEDKDMYSRFIIELTPRLKDMGLVVSVDVTAPDGSETWSMCFDRNVIGDVADYII
FMAYDQYGTSSNKSGTTAGYDWVNVSLNKFLKTEEIKSDKIILAIPLYTRLWTEDSSGKV
VKQTTVALKNMYNVIPAGVEKQWDDNLKQYYVEYQDGQYTKKIWIEDEKSLKEKISLIKN
NNLAGVASWEKGMETDNFWTFLKESLDF

Enzyme Prediction     

No EC number prediction in MGYG000000432_01385.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	32	316	3.2e-41	0.8445945945945946

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	1.56e-67	31	322	22	313	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	2.15e-37	37	327	130	423	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd06549	GH18_trifunctional	1.97e-29	37	319	26	298	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
smart00636	Glyco_18	1.63e-27	89	310	83	330	Glyco_18 domain.
pfam00704	Glyco_hydro_18	1.44e-24	89	313	80	306	Glycosyl hydrolases family 18.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXM06578.1	1.50e-82	5	327	231	552
QSQ09420.1	3.68e-80	5	327	229	547
AGC69431.1	1.53e-77	2	326	243	566
ANX02305.1	1.53e-77	2	326	243	566
ANW99679.1	1.53e-77	2	326	243	566

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3K_A	1.18e-20	38	325	138	426	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
5JH8_A	8.84e-20	36	326	26	314	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]
3CZ8_A	1.86e-17	43	310	41	307	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
4S3J_A	2.33e-13	81	325	179	424	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
3CO4_A	6.89e-11	38	317	32	287	Crystalstructure of a chitinase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],3FND_A Crystal structure of a chitinase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32258	1.63e-27	35	324	52	341	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1
O31682	9.46e-23	13	237	11	217	Putative glycosylase YkvQ OS=Bacillus subtilis (strain 168) OX=224308 GN=ykvQ PE=3 SV=1
P37531	6.11e-18	91	327	186	424	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
O05495	2.63e-17	43	310	133	399	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
P0DPJ9	9.41e-13	81	325	178	423	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000432_01385.