CAZyme Information: MGYG000000433_01447

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; ML615J-28; CAG-313; UBA1737
• CAZyme ID: MGYG000000433_01447
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
511	MGYG000000433_46|CGC1	58263.55	5.8693

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000433	1914532	MAG	Sweden	Europe

• Gene Location: Start: 6870; End: 8405 Strand: +

Full Sequence      

MKKISEMTLKEKIGQLFIVGFSNPYYDENIKDLIEENKVGNIILFARNYENANQLKKLNT
CLHQEVYKNTGIIPFIMMDQEGGMVTRMMTDVTFPPSQMTSSASNFDGAIYECGKMIARD
MIKLGMNLDLAPCLEINPGLENVLTNVRSYSSNPMSIAKKTNEFLKGLKEYGVLGCAKHF
PGAGFDEVDSHLDLPIINENKETVFNTSLVPFRKNIDVDAIMTTHSLFKAYDDLPATMSE
KVITGLLRKTLGYEGMIISDCMEMKAIENYYGTTNGILMALKAGCDMVIVSQTYAVQKLS
FNEVYQAIQDGRITEEEINEKVKRILKFKEKSSKSLKKYFIPNEPYQESKLFKTESLEIV
EKSLTLIKGTNVKVDNETVIITATPNIASFVEDVFDKNSLYKEIKNAFKDNMIISFDENI
KILLEKIKKEKQIVILSYDVSYNHNQKEIINEILTKYENVYVISFKGPFDQKFFTNLKNY
LCLYEYTPNAIITIIKYLKGEIKPEGKLPLD

Enzyme Prediction     

No EC number prediction in MGYG000000433_01447.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	69	289	2.5e-47	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00933	Glyco_hydro_3	2.03e-76	8	325	1	313	Glycosyl hydrolase family 3 N terminal domain.
COG1472	BglX	1.43e-73	7	325	1	308	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK05337	PRK05337	3.24e-41	39	290	26	279	beta-hexosaminidase; Provisional
PRK15098	PRK15098	7.04e-10	4	371	42	402	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVK18519.1	9.39e-122	1	511	1	518
AAM23516.1	1.64e-121	1	510	1	524
AAQ01678.1	1.64e-121	1	510	1	524
ADH60057.1	3.29e-118	1	510	1	524
ABY91501.1	3.87e-118	7	511	1	519

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	7.32e-82	7	509	11	528	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
4ZM6_A	1.68e-69	8	511	8	526	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
3BMX_A	2.16e-59	4	511	39	616	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	7.17e-59	4	511	13	590	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.22e-58	4	511	43	620	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	1.18e-58	4	511	39	616	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	2.54e-38	30	343	55	394	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
Q6LJ30	5.81e-37	31	290	18	273	Beta-hexosaminidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=nagZ PE=3 SV=1
C4LEY6	5.36e-35	27	295	14	281	Beta-hexosaminidase OS=Tolumonas auensis (strain DSM 9187 / TA4) OX=595494 GN=nagZ PE=3 SV=1
P44955	7.66e-35	32	290	19	278	Beta-hexosaminidase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000433_01447.