CAZyme Information: MGYG000000435_01194

Basic Information

• Species: RUG131 sp900549975
• Lineage: Bacteria; Firmicutes; Bacilli; RFN20; CAG-826; RUG131; RUG131 sp900549975
• CAZyme ID: MGYG000000435_01194
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
806	MGYG000000435_5|CGC2	91699.74	7.1444

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000435	1948428	MAG	Sweden	Europe

• Gene Location: Start: 105224; End: 107644 Strand: +

Full Sequence      

MDIKSKITQMTLDEKTKLLSGYKTMNTYPLNRLDIPSLNLSDGPNGLRKEDESGDSLNGV
SNSLPATCFPTGVTLASTWNKNLLYKVGKAIGEECNFYDINVLLGPAINIKRNPKCGRNF
EYYSEDPLLSGYLASEYIKGVQSQNVAATLKHFACNNNEKYRFTGDSIVDKRALHEIYLK
PFELAVKHAKPWAVMNAYNKINGIHASENNHLMNEILRNSWHFDGLVMTDWGGIVDRVKG
LEAGTDLEMPGMIEHNIISLYNAVKDKKIDESLVDKSVENVLKTVERTRTNRHKCDFEKN
YNLAIEVARSGAVLLKNDNILLISKETKVHVIGGLFEEIRYQGSGSSLLNPKKLSYHKDG
FLKRNIDYHFSLGYKASELKSDEKLEQEALNELKDNELILYYMGQNDYVESEGFDREVTT
LPENQLNLLNKLLDLGKKVVVILFGGSFVELPFLDKVKAILYMGLAGEGIGEATNDLIFG
EYSPSGRLTETWPLSYQDVPFGENFTLTPNEIYKESIYVGYRYYETINKNVAFPFGYGLS
YTNFAYSDIKVKTNNQDISVSLKVKNIGNFDGEEVIQIYVSHLNSNIYQPIKELKAFDKV
KLKVNEEKIISISISNDDLKIYDINSDEFILEDGKYKIIIGKNAHENILEKDIDIKGLTL
EKTKENIKKYYENINNLIDISDIEYAKLFDLNINNYEFSKLPYTMETPIGEFNSFVGKIF
KNAVCNVGLKQYKKALKLKDGPKKEREKKTGLFVYKLMPNNSLRSLCYSSSGQLTYNIAK
GLEQFINGHYIKGIKAMLRKEKRNEK

Enzyme Prediction     

No EC number prediction in MGYG000000435_01194.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	31	250	1.9e-68	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	2.27e-69	31	344	56	371	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK15098	PRK15098	2.10e-66	67	641	118	751	beta-glucosidase BglX.
PLN03080	PLN03080	2.99e-56	4	650	54	778	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	3.76e-37	55	282	73	314	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	6.95e-30	312	521	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOS39545.1	9.54e-249	1	806	1	806
QYH55292.1	7.16e-240	9	798	15	812
QFU98405.1	1.64e-197	10	799	19	809
QKJ20505.1	6.96e-194	7	797	14	805
BCL84647.1	9.63e-194	1	798	1	868

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	2.18e-183	1	674	3	687	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.12e-141	7	662	9	674	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.33e-133	7	657	8	709	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	2.04e-132	7	657	8	709	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	3.32e-109	2	658	5	845	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	1.19e-182	1	674	3	687	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	5.63e-140	7	646	9	663	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	2.20e-139	7	646	9	663	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	2.93e-118	3	646	46	736	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
P07337	4.61e-110	2	658	5	845	Beta-glucosidase OS=Kluyveromyces marxianus OX=4911 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000435_01194.