CAZyme Information: MGYG000000435_01196

Basic Information

• Species: RUG131 sp900549975
• Lineage: Bacteria; Firmicutes; Bacilli; RFN20; CAG-826; RUG131; RUG131 sp900549975
• CAZyme ID: MGYG000000435_01196
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
854	MGYG000000435_5|CGC2	98622.44	8.9614

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000435	1948428	MAG	Sweden	Europe

• Gene Location: Start: 109543; End: 112107 Strand: +

Full Sequence      

MKVDNVLIEYLNNPIGIGIRSPRITWNDFDINKQDSFEVFYEVNGVRKTSGIIKSSSMNY
IFKEEFQSRNYVSFKIKIYDKNGNCSDDSLAYNFEMGLLSPNDWVSHWISGNYKVNKNKR
YPVDYFKKDINIKSIKKARLYISACGLYEAFINDVRVGNFILTPGSTDYHKRIQYQTYDV
TNLLKEGKNVINLLLADGWYRGSIGAKGRRNTYGTVTKVIAQLEVFDNDNNKTTYVTDDS
WAWSNDGPIQFSDLKDGEIIDNRKVPSYKGKAKIVKFDANLKESNNEAVIENEYHKPIKI
WKSKSGKQIVEFPNNIAGYISFFIKAKKGDTISIEMGEILDDDGELTLKNIQCVHKKKKT
PLQKIIYTCKDGENNYHSKFYFAGFKYLSIDSNIEFNKENIQQIGISTKLDNTSSFKCSN
KLINIFYDNTLRSLRSNSIDIPTDCPTRERMGWTGDSQVFFETASFLTNYAAFTRKHLVD
IFDRQTKNGCLPQIAPYSSEDWFMSVMNGSVGWADVGILSPLRFYKKYGDKRILIDNYEK
MVKYAKFMINRCGRAKGIYAIYAKPLHLSKENKKYAVNTGQSYGEWAEPNDIKAFVWTDF
AEPHPEESMAYTYWMMDNMIEISNIIGRKENNALFIEYRDGINKAYQELVDKNRFSLDTN
RQAKLVRPLYLNLLNEEQKIKAKKNLIKALNDYDWRLGTGFLSTPFILYVLSDIDVNYAY
KLLENEKMPGWLYMAKNNTGTIWEAWEGPNAQQGIASLNHYSKGAMVEWLFKGMCGINII
KENMIRISPIIGGNIKFANASYQSIYGLIKSSWKIEDNKIVFEIEVPGNVECEFEYKDIK
KHLENGKHVIEYSL

Enzyme Prediction     

No EC number prediction in MGYG000000435_01196.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	300	834	4.1e-120	0.9940476190476191
CBM67	107	266	1.1e-25	0.8352272727272727

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	4.04e-80	411	774	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	9.68e-50	133	266	1	134	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	2.97e-15	785	851	12	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	5.84e-12	302	407	2	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWI66986.1	0.0	1	848	7	857
AHF25263.1	1.04e-298	1	833	1	826
QFJ55302.1	8.70e-289	1	829	1	841
QUC03017.1	1.08e-252	1	848	1	878
QZN73695.1	3.55e-199	1	854	2	859

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GSZ_A	4.05e-96	1	816	2	819	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	7.45e-91	9	833	38	895	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	2.90e-83	133	833	314	991	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	4.77e-97	68	835	113	877	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	1.35e-82	133	833	314	991	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	1.49e-78	13	834	42	876	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	2.10e-62	1	847	30	919	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000435_01196.