CAZyme Information: MGYG000000436_00234

Basic Information

• Species: CAG-306 sp000980375
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; CAG-306; CAG-306 sp000980375
• CAZyme ID: MGYG000000436_00234
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
203		22327.95	9.9445

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000436	2103098	MAG	Sweden	Europe

• Gene Location: Start: 229699; End: 230310 Strand: +

Full Sequence      

MIRKLLTLTLLFILCILNPNQSQAETSKATVKDYIVKHSLEMGIDPALGLSIAKMESGFV
HEKRSSFGAVGVFQLMPSTARRLGYNPYYLSDNIRGGLMYYKMMYQKFGSVELALAAYNA
GPGNVSKYKGVPPFAETKRFVRGIMSEYYAQKANPDPAITKYQGKGTIDAVNKALTIDKD
NNVLKTNANSLENLPIVTLSGAI

Enzyme Prediction     

No EC number prediction in MGYG000000436_00234.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	41	153	9.7e-24	0.8518518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.24e-32	32	148	5	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00254	LT-like	4.54e-31	46	148	1	110	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.22e-29	32	150	7	147	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd13403	MLTF-like	1.89e-22	35	125	1	99	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	3.57e-20	43	138	9	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39353.1	7.39e-62	3	161	2	159
QJT08226.1	2.78e-31	28	148	79	200
APC48072.1	6.13e-31	16	148	72	206
APH07128.1	3.16e-30	17	150	75	204
AIF43250.1	4.81e-30	16	148	72	206

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	1.67e-12	32	150	417	556	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	1.68e-12	32	150	421	560	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	1.68e-12	32	150	427	566	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.69e-12	32	150	431	570	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	1.69e-12	32	150	437	576	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	1.69e-28	22	150	51	181	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	4.13e-27	34	162	1425	1555	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	4.13e-27	34	162	1425	1555	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P27380	2.62e-08	39	178	15	149	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
P39434	8.21e-08	33	146	482	620	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000246	0.998982	0.000267	0.000161	0.000158	0.000145

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000436_00234.