CAZyme Information: MGYG000000436_02005

Basic Information

• Species: CAG-306 sp000980375
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; CAG-306; CAG-306 sp000980375
• CAZyme ID: MGYG000000436_02005
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
558	MGYG000000436_14|CGC1	64419.61	9.8423

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000436	2103098	MAG	Sweden	Europe

• Gene Location: Start: 9337; End: 11013 Strand: -

Full Sequence      

MNKASILKFFKRHKDLIAIFVILFVCYFLYFFSMGSYPLIDVDETRYVAMSRDLFHANDL
LTLYLNGDYFFEKPPLYFWLEVLSFSIFGKITEATARIPVALCAVFGVGITYFLGSKISS
KKYGLICALILASCFEYVVLARVAILDMLLSVCIAASAFSGIYTLFCSHRFKKYFWWLAY
IWAGFAVMAKGVPGLAIPALTIFISYIIAGRFKEMFKPLYIIPGLVLFFIVTLPWHIIML
QKYGYVFFREYIYKHHFERFANSHELGRKQPFYYYIPVFFLGFMPWIFSFGAQITVFFKK
HFKNIQGYFDKFCDLQPLHKFMVLNTVFFLVVFGFYSAASTKLPTYILPAMFPAAMILGK
FWFDYIFKDENERAVNISTIILNFAFILTAIGLTVVPQFIREADRAGLEAMQIPGVIVIM
ASVLFNSFAIFKDKKKLHFIALVGFMAVLSMFAAKMIFPYVVSFGQNELIEYAKTAKNKG
AKLAAMGTGNRYSLIYYAESQIDFIKDFKIDNNALDKGTYVIVRNKNVKDFNNLYNYEII
KQGKKYSLYNNAIPKTKK

Enzyme Prediction     

No EC number prediction in MGYG000000436_02005.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	16	506	2.7e-101	0.8796296296296297

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	3.35e-49	14	462	5	432	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	7.49e-34	18	442	9	415	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	2.47e-13	73	235	2	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	1.22e-06	63	243	52	238	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1287	Stt3	0.002	8	456	8	411	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38667.1	4.22e-140	9	548	7	553
BBB92576.1	4.13e-50	14	428	5	390
QWV94985.1	5.55e-48	11	499	17	480
ACH39987.1	6.55e-46	11	370	14	352
QXE88090.1	3.25e-45	11	499	14	477

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	3.56e-25	21	359	34	360	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B4ETL9	7.20e-25	2	396	4	369	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT2 PE=3 SV=1
O67270	1.72e-23	29	399	15	354	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
A1JPM4	3.17e-23	30	387	20	359	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=arnT PE=3 SV=1
Q7N3Q9	4.21e-23	30	393	22	366	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=arnT PE=2 SV=1
Q8ZDX9	3.19e-21	16	415	11	395	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pestis OX=632 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000003	0.000000	0.000000	0.000000	0.000003

TMHMM  Annotations     

start	end
16	38
94	116
123	140
145	167
174	191
195	212
219	238
276	298
318	340
345	367
374	396
411	430
437	454