CAZyme Information: MGYG000000437_00173

Basic Information

• Species: Alistipes sp001941065
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp001941065
• CAZyme ID: MGYG000000437_00173
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
510		57611.6	5.4532

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000437	3341375	MAG	Sweden	Europe

• Gene Location: Start: 9894; End: 11426 Strand: -

Full Sequence      

MKLRAFLLIATLHFTVLASCARETPETPAPPRPGEEGYKTIDLTGYRLIFSDEFDGKKMN
WDIWAAENPNNIKHETSRGPEAVEVRDGELRLNVRKVDRSEKIKWIAGYVYLKEPLENNV
YIECRFRSGASSGVNNAFWLACKTPPNNTWCNKYEVDIVEARKDVRTGKGNGHLAYHDWK
TYPYALDRNGNKCDIAAGIAVEHDFDKYHVWGLWYGENEMIYYLDGEELWRGTTSKTYPD
QYYTGVGKAPKWNPLEEQRAYGKYGQEDWNYLGGYNGDKMHVILANIPWGSAWSPLVDEE
ADGTWMAVDYVRIYKPEALLDPTPDTDLKEPRAETALDKAYSLAEDGCIYFSTEITKKPG
EELTLTFTDTDNAPVGKVIVDTEGSLLTGITRLTSSKVAASVVQGKQLVRDNEKTLLVCR
ITAKASRGKYDKDAISVWCTPAADAAKASEPYFYPNLDENGNTSATQGWYISQKGYSDEI
IRRVVFSSTSGELSSFGRFRAGRNFRCVTR

Enzyme Prediction     

No EC number prediction in MGYG000000437_00173.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	51	314	8.4e-21	0.991304347826087

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02178	GH16_beta_agarase	1.22e-16	50	315	25	258	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.
cd08023	GH16_laminarinase_like	2.38e-10	50	314	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd00413	Glyco_hydrolase_16	1.91e-08	52	314	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
COG2273	BglS	0.003	10	267	14	271	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWI09464.1	4.55e-122	2	508	7	516
AQQ10032.1	2.05e-19	27	353	1171	1449
AUP79711.1	6.82e-18	7	318	9	260
QGY47521.1	2.97e-17	48	314	33	256
AWW29604.1	8.94e-14	46	315	41	264

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VY0_A	5.44e-07	41	314	8	259	TheX-ray structure of endo-beta-1,3-glucanase from Pyrococcus furiosus [Pyrococcus furiosus],2VY0_B The X-ray structure of endo-beta-1,3-glucanase from Pyrococcus furiosus [Pyrococcus furiosus]
1UPS_A	1.38e-06	6	227	4	233	GlcNAc[alpha]1-4Galreleasing endo-[beta]-galactosidase from Clostridium perfringens [Clostridium perfringens],1UPS_B GlcNAc[alpha]1-4Gal releasing endo-[beta]-galactosidase from Clostridium perfringens [Clostridium perfringens]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000022	1.000037	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000437_00173.