CAZyme Information: MGYG000000437_00230

Basic Information

• Species: Alistipes sp001941065
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp001941065
• CAZyme ID: MGYG000000437_00230
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
398	MGYG000000437_4|CGC1	46242.13	9.4139

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000437	3341375	MAG	Sweden	Europe

• Gene Location: Start: 22538; End: 23734 Strand: +

Full Sequence      

MKKFLLAVQTLLLLAAASNVQAQKSYDLKKFPKGCQPEEIGIRLTERYLQTPHSHWGDVN
SKHKVTLVTYPDVCAWLGALWFTAGTGNDSLYTRLVERFEPLFTTQKNLQPNLFPKDHNV
VDFYVFGAVPLEIYKRNHDPKYLELGMKYADGQWALPANPQHYKQLSEAKKYADEGYSWQ
TRLWVDDMFMITDLQAQAYLVTGDKKYIDRAAREMALYLDRIQRPNGLFYHHTGTPYFWG
RGDGWMAVGMAEMLRMLPKDNPYLPRIRAAYMQMMETLLRYQGYDGMWRQIIDNPNSWKE
TSSTAMFTYAMILGVKNGWLDRKTYGTAARKAWLTLLSYLDEKDNLRNVCEGTGAKNSFD
WYQNRRRLTGDLHGQAAMLWCAYALSCDVKPYKLTPKR

Enzyme Prediction     

No EC number prediction in MGYG000000437_00230.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	64	384	2.6e-66	0.963855421686747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	4.56e-44	133	383	84	337	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	3.18e-37	131	379	89	347	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEH42438.1	7.58e-184	25	390	41	404
AWO00682.1	3.00e-176	25	391	41	405
SCD21779.1	2.93e-161	24	388	40	387
BBE16470.1	1.12e-156	1	385	1	373
ALJ58453.1	1.99e-153	27	385	27	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NC5_A	1.11e-26	113	379	81	358	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	4.68e-26	113	379	71	348	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3K11_A	1.23e-25	183	380	199	405	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
5NOA_A	1.03e-18	184	356	158	344	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	5.21e-18	184	356	141	327	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	6.08e-26	113	379	81	358	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P9WF04	6.20e-16	167	333	184	362	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
T2KPL9	1.29e-14	162	336	135	329	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
O31521	1.84e-14	107	363	62	313	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
L7P9J4	5.90e-13	233	364	226	360	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000274	0.999017	0.000179	0.000177	0.000167	0.000149

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000437_00230.