CAZyme Information: MGYG000000437_00246

Basic Information

• Species: Alistipes sp001941065
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp001941065
• CAZyme ID: MGYG000000437_00246
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368	MGYG000000437_4|CGC2	41075.07	4.9175

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000437	3341375	MAG	Sweden	Europe

• Gene Location: Start: 51127; End: 52233 Strand: +

Full Sequence      

MKHLLTLAAGTALLTAACSGPEHRPSDPQADKAACALYERLFELRDRGVMLGQQDALAYG
HQRYEPGFSDVYDMTGDYPAVVGWEIGHVELGAPYSLDSVYFDDIRRGIAATAARGGIST
ISWHGDNILTGGSTWDCSRNDVVASILPGGSHHNEYLAQLDRVADFLLSLKDAQGGAIPV
VLRLYHEQTRSWFWWGADFATPDEYKALWRMTVGHLRDTRGVHNVLYGYSPTDVEDEAGY
LERYPGDEWVDVVGFDLYHFGSDAAATEHYMANMRRNLRIVADYAARSGKLPVMAETGME
GIPVTDYFTRVVAPVIEPSGMAWILFWRNAWEPDKPGHFYLPYKGHAAEGDFKAFIADDR
ILMNQDIR

Enzyme Prediction     

No EC number prediction in MGYG000000437_00246.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	26	333	1.3e-60	0.9174917491749175

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	3.08e-42	27	292	2	264	Glycosyl hydrolase family 26.
COG4124	ManB2	2.44e-14	135	332	144	322	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIA99594.1	1.49e-154	25	368	23	367
BCI64729.1	5.89e-145	22	367	23	369
QIK53347.1	6.76e-145	24	368	30	373
QIK58764.1	3.88e-144	27	368	33	373
AGC01502.1	4.24e-138	7	362	14	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZXO_A	3.84e-86	36	366	14	338	Thestructure of a GH26 beta-mannanase from Bacteroides ovatus, BoMan26A. [Bacteroides ovatus]
2VX5_A	4.87e-74	27	367	35	391	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
2VX4_A	4.87e-74	27	367	35	391	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
4CD4_A	9.19e-74	27	367	58	414	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
2VX7_A	3.83e-73	27	367	35	391	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49424	2.55e-63	27	367	51	411	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
A1A278	1.43e-49	6	363	23	394	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
P49425	3.93e-21	20	264	137	383	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
Q5AWB7	2.75e-17	4	272	7	280	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
G2Q4H7	3.17e-17	14	293	159	428	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000042	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000437_00246.