CAZyme Information: MGYG000000437_00439

Basic Information

• Species: Alistipes sp001941065
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp001941065
• CAZyme ID: MGYG000000437_00439
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1035	MGYG000000437_8|CGC1	116313.57	6.0878

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000437	3341375	MAG	Sweden	Europe

• Gene Location: Start: 14614; End: 17721 Strand: -

Full Sequence      

MKRLLFLTLFAATAVSAKAPAERWLDPECFAVGRAPMRTSFIVFPTASEAVPENDYTRSP
LYRTLNGEWSFLRVDHPGAEPEGFFRVGYDDSAWGAMPVPGIWELNGYGDPVYTNKPYPW
HKFFEVKAPLVPHEQNYTGLYRRTVTVPADWQGRDVFIHIGSAISNVTLWVNGHEVGYSE
DSKLEAEFDITRYITPGRDNLIVLRVNRWCDGSFLEDQDFWRLSGIGRDCYLYTRDKRRL
ADVRLTPDLVNDYRDGTLRVEAATTPGVGSVRLTLRDDRGRTLDTRTLKPRRNSAATTFE
VAAPKPWSAEAPNLYTLTAEALAADGSVTEAAAFRVGFRKVEICGGQLLVNGKAILIKGV
NRHEMEPNTGYCVTREEMIRDIREMKRLNMNAVRTCHYPDVPLWYDLCDEYGLYVVDEAN
VESHGYHYRDKAKSLAGNPAFAAAHLDRNRRMVLRDYNHPSIIIWSTGNEAGNGPNFERC
YDWIKAFDPSRPVQYEQASYHGDYNTDIVCPMYWSYEQCEKYLADNPAKPLIQCEYAHAM
GNSLGGFKEYWDMTRREPKYQGGFIWDFADQALAWRSPEGRLTYRYGGDYNDVDASDSTF
CCNGVLASDRSWHPHAYEVKHQHRPIHTTARDLKKGVVNVFNENFFTDLSPYRLLWEITA
DGRPVLSGVIEHLDVAPQATAAVTLGYNAEQLRSFGGELLLTVRYQLRERQGLLDALHEV
AADQLVLREDDPAVRFAAAAPAGTLRIADRTVSGEGFSVTFDPASGSISSYKLRNVELLA
GPMRPNFYRAATDNDLGVRQTGKYPDSRIWATAELQLAGFTLTSGENEVRAAADYTLPAV
GAKLRLSYVIAADGSVRVCETMTADPTRKDVAELMRFGMAFETPGMFDAVEYYGRGPMEN
YADRASAAFVGHYAQRVADQFHLKYASPQESGTRGGLRWWRLTDPTGFGIEICSDRHFSA
AAIPYSIPQLDNGSPEYVRHPGDLVPDGRTHVSIESVQSGLGCINSWGRQALPQYRLPYG
DYSFNFRISPVAGGM

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	56	910	2.8e-220	0.9680851063829787

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09525	lacZ	0.0	24	1030	17	1026	beta-galactosidase.
PRK10340	ebgA	0.0	21	1034	1	1003	cryptic beta-D-galactosidase subunit alpha; Reviewed
COG3250	LacZ	4.30e-142	57	912	7	808	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	3.42e-105	341	627	1	301	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
smart01038	Bgal_small_N	2.34e-84	753	1028	1	272	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK64552.1	0.0	1	1034	1	1034
BBL03315.1	0.0	1	1031	1	1031
BBL03117.1	0.0	1	1031	1	1032
BBL15153.1	0.0	1	1031	1	1032
BBL06016.1	0.0	2	1032	3	1021

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DEC_A	1.71e-212	30	1034	11	1000	ChainA, Beta-galactosidase [Bacteroides thetaiotaomicron VPI-5482]
3BGA_A	1.34e-207	16	1034	2	1004	Crystalstructure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],3BGA_B Crystal structure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
6S6Z_A	3.16e-202	24	1028	4	979	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	3.25e-202	24	1028	5	980	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
3MUY_1	2.81e-166	24	1024	16	1016	Chain1, Beta-D-galactosidase [Escherichia coli K-12],3MUY_2 Chain 2, Beta-D-galactosidase [Escherichia coli K-12],3MUY_3 Chain 3, Beta-D-galactosidase [Escherichia coli K-12],3MUY_4 Chain 4, Beta-D-galactosidase [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O52847	3.05e-202	26	1031	23	1034	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
Q56307	1.78e-201	24	1028	5	980	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
Q9K9C6	6.09e-188	24	1031	9	1014	Beta-galactosidase OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=lacZ PE=3 SV=1
Q6LL68	8.58e-181	63	1030	47	1027	Beta-galactosidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=lacZ PE=3 SV=1
Q7MG04	1.74e-180	63	1032	48	1030	Beta-galactosidase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000248	0.999134	0.000156	0.000154	0.000143	0.000130

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000437_00439.