CAZyme Information: MGYG000000437_00827

Basic Information

• Species: Alistipes sp001941065
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp001941065
• CAZyme ID: MGYG000000437_00827
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
771		85430.49	4.9224

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000437	3341375	MAG	Sweden	Europe

• Gene Location: Start: 13043; End: 15358 Strand: -

Full Sequence      

MNTKFRHWTFLFTAAVLAAPGCSGNADPVYKDASQSVERRVEDLLSRMTLEEKIGQMCQY
VGLNHMRQTAVVLSEAEMKKSHAMGFYADCPPERIEEMIREGITGSFLHVTSVEEANYIQ
SLALQSRLAIPVLIGIDAMHGTGLVRGATVYPTEIGQAAAFNPELVERIGRETALEMRAS
GSQWTFGPNIEVARDARWGRVGDTFGEDPYLVSQLGVATVKGLQGRDFTGEDYVIACAKH
MAGGSQPVNGINGAPNDMSERTLREVFLPPFEKCVEAGIYTVMAAHNEYDGIPCHGSRFL
LTDILRDEWDFGGFVVSDWMDIERMQDYHTTGETLRDVYAQTLDAGMDMHMHGPDFYYEV
LKMVREGVVPESRIDASVRPILAAKFRLGLFENPYVDEETTRSTLFCEEHRATALEAARQ
SVVLLENDGILPLDPAKYRRVLVTGPFADNQVQLGDWAFEQPDENVTTVWEGLQAVSPGT
QFTLCDLGWNIRKITPGQVRNAVRQAAGKDLAIVVAGENSLRYHWTEKTCGENSDRYDIS
LYGEQEPLIRALHATGIPVVVVLTNGRPLSTEWISANVAALVEAWEPGSLGGQAVAEVLY
GRVNPSGRMPISVPRHSGQIPVYYNHKFTHHWFRYATGDSSPLYEFGYGLSYTTFEYGDV
ELSSATMAPDGQLTASVSLTNTGGVAGTEVVQLYLRDKVSSATRPVKELKDFRRVTLAPG
ESVRVEFTLTPDKLAYYDAKMHYGVEPGDFEVMIGSSSRDKDLRRAVFTVK

Enzyme Prediction     

EC	3.2.1.37	3.2.1.55	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	124	351	1.6e-75	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	8	760	3	756	beta-glucosidase BglX.
COG1472	BglX	3.56e-97	48	458	1	372	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	4.83e-83	1	734	1	747	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	1.72e-77	49	382	1	314	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	5.70e-58	422	652	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL39934.1	0.0	30	771	28	770
QIU93423.1	0.0	17	771	16	770
ALJ60237.1	0.0	21	771	16	768
QUT88989.1	0.0	13	771	12	769
ALJ59996.1	0.0	13	771	12	769

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	7.70e-156	35	771	8	752	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	4.28e-155	35	771	8	752	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5Z9S_A	7.40e-153	30	770	17	787	Functionaland Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum],5Z9S_B Functional and Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum]
5TF0_A	1.72e-144	35	759	7	741	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
5Z87_A	2.47e-143	9	760	18	776	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	2.23e-147	116	771	51	723	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
Q56078	1.55e-134	41	758	38	754	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	5.96e-130	26	758	20	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH9	1.82e-129	30	760	29	746	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
Q23892	1.05e-117	41	756	80	813	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000482	0.394596	0.604458	0.000160	0.000163	0.000141

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000437_00827.