CAZyme Information: MGYG000000437_01183

Basic Information

• Species: Alistipes sp001941065
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp001941065
• CAZyme ID: MGYG000000437_01183
• CAZy Family: PL17
• CAZyme Description: Exo-oligoalginate lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
735	MGYG000000437_33|CGC1	82058.71	6.506

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000437	3341375	MAG	Sweden	Europe

• Gene Location: Start: 15135; End: 17342 Strand: -

Full Sequence      

MKKLFLTFLFALPAFILTAGEHPSLLLTKKGVAAMREAHGKVPAFDAVMVRTLAGADAAV
ASEIVVPEPRDGGGGYTHERHKLNYYEMVDCGIAWQVTGEEKYARRVAEMLAAYAKLYPT
LGFHPMTLSKTPGRIFWQTLNESVWLVHTAMAYDCVYDYMTPAQRADVEKNLFCPMADFM
MNGLEGNRGNNKVFNKMHNHATWATSAVGMIGMAMGDDTLVNKALYGTDETGKKGGFIRQ
LDYLFSPDGYFTEGAYYQRYAIWPFMVFAQCIEHSRPDLKIFAYRDGILLKAVSTLLQLA
YDGRFMRFNDSLEKGYDAQELVYAVNIAYNADPSNKMLLDAAARWQDWVLPTDAGFAVAR
DIARGEAQPLVFRSALFRDGRRGDEGGVAVLRSTDPALNSALTLKATSHGLSHGHYDKLT
LAYYDNGNEILADYGAARWLNIEAKYKGHYTPENKTFAMQTIAHNTLVVDEQSHFGGDYD
ESMKHHSDIYFADFAREGVQVVSAKENNACPGVRMHRTAAYVTTSFLQYPLILDILRAES
AAEHRYDYPMWYNGHLVSLNFPYERALSTMSALGTANGYQHLWRQAAGHNEASGTSIFTW
ITGNRFYSLSTLTTPASEMVLVEAGANDPDFNLRSEKAYIVREEGKKNHTFFSSIETHGT
YDLQVEQSDNLTSSCLGLRLVADTPDYTVAVADYRGGHSVTLCVSNRTADAAVRHSVKTS
EGRFEWIGPYDVKIK

Enzyme Prediction     

EC	4.2.2.-	4.2.2.3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL17	387	523	6.9e-46	0.9699248120300752
PL17	187	266	1.3e-24	0.6240601503759399

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05426	Alginate_lyase	5.61e-19	74	298	40	266	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.
pfam07940	Hepar_II_III	8.67e-14	378	547	4	159	Heparinase II/III-like protein. This family features sequences that are similar to a region of the Flavobacterium heparinum proteins heparinase II and heparinase III. The former is known to degrade heparin and heparin sulphate, whereas the latter predominantly degrades heparin sulphate. Both are secreted into the periplasmic space upon induction with heparin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL39960.1	0.0	1	735	1	735
QUT26278.1	0.0	1	735	1	735
EGN08295.1	0.0	1	735	1	735
QIU93441.1	0.0	1	735	1	735
QNT66845.1	2.13e-288	1	733	1	729

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7BJT_A	3.23e-211	19	734	25	750	ChainA, Alginate lyase, family PL17 [Zobellia galactanivorans],7BJT_B Chain B, Alginate lyase, family PL17 [Zobellia galactanivorans]
7BM6_A	7.35e-210	19	734	25	750	ChainA, Alginate lyase, family PL17 [Zobellia galactanivorans],7BM6_B Chain B, Alginate lyase, family PL17 [Zobellia galactanivorans]
4NEI_A	7.42e-192	9	735	16	734	Alg17cPL17 Family Alginate Lyase [Saccharophagus degradans 2-40],4NEI_B Alg17c PL17 Family Alginate Lyase [Saccharophagus degradans 2-40]
4OJZ_A	1.67e-190	9	735	16	734	CrystalStructure of Alg17c Mutant Y258A Complexed with Alginate Trisaccharide [Saccharophagus degradans 2-40],4OJZ_B Crystal Structure of Alg17c Mutant Y258A Complexed with Alginate Trisaccharide [Saccharophagus degradans 2-40],4OK2_A Crystal Structure of Alg17c Mutant Y258A [Saccharophagus degradans 2-40],4OK2_B Crystal Structure of Alg17c Mutant Y258A [Saccharophagus degradans 2-40]
4OK4_A	3.34e-190	9	735	16	734	CrystalStructure of Alg17c Mutant H202L [Saccharophagus degradans 2-40],4OK4_B Crystal Structure of Alg17c Mutant H202L [Saccharophagus degradans 2-40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q21FJ0	4.06e-191	9	735	16	734	Exo-oligoalginate lyase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) OX=203122 GN=alg17C PE=1 SV=1
B2FSW8	5.10e-173	11	730	26	731	Alginate lyase OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt2602 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001520	0.692508	0.305273	0.000208	0.000235	0.000239

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000437_01183.