CAZyme Information: MGYG000000437_01296

Basic Information

• Species: Alistipes sp001941065
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp001941065
• CAZyme ID: MGYG000000437_01296
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
592		66142.02	5.6413

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000437	3341375	MAG	Sweden	Europe

• Gene Location: Start: 20279; End: 22057 Strand: +

Full Sequence      

MKKILLICLLWLAAGPVGAQTNVLEKGLEGRSLDDSELSRKYIVPSRIIPLPGDESRGVT
NAEALLKPFDGQLSTTTGDFCLMTTSEGRRASVLLDYGKELYGGIEIASPMRPSLLPIRV
RVRMGESVSETMSDAESRTDFECPMATATNEHTMRDFTLEIPWLGSVEIGNSGFRFVRID
LLDEDAVLPVKSVRAVLRYRDIPYLGSFCCDNERLNAVWETGAYTVHLNMQNYLWDGIKR
DRLVWLGDMHPEVMTIQSVFGDNPVVRKSLDFARDNTPLPEWMNTISAYSMWWILIHRDL
YLYQGDLDYLKEQQTYMKALLRQLMASTDGPKEKMENGFRLLDWPTSRSPEIIHAGYQAL
LVMCMEAGVQVGEWIGDTEMRRECADALTLFRTYVPPHLGNKQAASLLALAGLVDPAEVS
RSVVAAGGPEGFSTFYGYYMLEALAQGGLHTEAMEIISRYWGAMLDLGATTFWENLDWNH
VANAARIDEIVPAGKFDIHACSGDFCYLGLRHSFCHGWASGPTPWLSRYVLGVVPVEPGC
RVVRVEPHLGGLKWVEGTFPTPHGVIEIRHEKGADGKIVTKIKAPKGVKVIR

Enzyme Prediction     

No EC number prediction in MGYG000000437_01296.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	90	589	2.5e-97	0.9781746031746031

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	7.79e-16	206	530	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	6.09e-07	532	589	1	58	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL00915.1	7.67e-307	1	592	1	587
BBD46130.1	7.10e-253	3	592	4	588
SCD21002.1	1.34e-250	3	591	4	588
BBL11632.1	3.85e-247	161	592	1	432
BBL08840.1	3.85e-247	161	592	1	432

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	5.19e-46	86	587	187	688	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	6.14e-13	92	531	94	543	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KM26	7.24e-07	207	566	732	1108	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000313	0.999042	0.000195	0.000142	0.000141	0.000137

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000437_01296.