CAZyme Information: MGYG000000437_01332

Basic Information

• Species: Alistipes sp001941065
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp001941065
• CAZyme ID: MGYG000000437_01332
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366		41809.64	4.4454

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000437	3341375	MAG	Sweden	Europe

• Gene Location: Start: 24; End: 1124 Strand: -

Full Sequence      

MFSYGNKNAYTAYGMVNNPTKIYFGNDNGWLPLYTAIFQAGYPTINNLKKIRLMITPYDG
KGGNYAKGIRRRIWINDVLVIDDWNGGDIWQGTHDGLPYDFGIDSGTGMITCNTFVADPN
YWNYSIPSETENEIIFYDDFDQADGLDYDSWSHVPYGTAAWQIYMSGSPDQAYVKDGKLI
LTIEKKDGKVVSGGIKTQGKKWFNNCRIEVCARFVEDAGSIGQAIWLMPEPMYQIYPGWP
HGGEIDIMEHSYLNDYVQQTLHSHYIDIYQETPSGKAAYADYNKGTFNVYSADLTDEEIV
FYTNDKETMRYANQHFPNESELMQWPFRGQYYLILSIGAAGRSEVQDADIPSFMEVDWVR
VTRLGN

Enzyme Prediction     

No EC number prediction in MGYG000000437_01332.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	138	361	1.5e-38	0.9826086956521739

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	2.36e-43	136	361	1	234	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd00413	Glyco_hydrolase_16	3.91e-17	138	362	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd08024	GH16_CCF	1.05e-15	134	341	1	276	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
cd02182	GH16_Strep_laminarinase_like	4.66e-10	134	361	4	257	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
cd02178	GH16_beta_agarase	8.77e-05	138	361	27	256	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL13664.1	4.30e-286	1	366	183	548
BBL05222.1	6.47e-281	1	366	183	548
BBL13671.1	8.31e-177	129	366	128	365
BBL05229.1	5.20e-174	129	366	122	359
BBL13670.1	1.34e-59	128	365	38	277

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2R_AAA	2.50e-26	133	360	30	259	ChainAAA, Beta-glycosidase [Bacteroides caccae]
6T2O_AAA	2.51e-25	126	366	29	277	ChainAAA, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185],6T2O_BBB Chain BBB, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185]
6T2P_AAA	6.63e-25	126	366	29	277	ChainAAA, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185],6T2P_BBB Chain BBB, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185],6T2Q_AAA Chain AAA, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185],6T2Q_BBB Chain BBB, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185]
6T2S_AAA	6.47e-21	134	365	2	241	ChainAAA, Glycoside hydrolase family 16 protein [Bacteroides finegoldii DSM 17565],6T2S_BBB Chain BBB, Glycoside hydrolase family 16 protein [Bacteroides finegoldii DSM 17565],6T2S_CCC Chain CCC, Glycoside hydrolase family 16 protein [Bacteroides finegoldii DSM 17565]
6XOF_A	2.06e-17	116	361	10	265	ChainA, GH16 family protein [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZG90	5.05e-31	117	364	41	289	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1
P45798	1.48e-19	133	363	41	283	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000437_01332.