CAZyme Information: MGYG000000438_01805

Basic Information

• Species: Zag1 sp000433095
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag1; Zag1 sp000433095
• CAZyme ID: MGYG000000438_01805
• CAZy Family: GT30
• CAZyme Description: 3-deoxy-D-manno-octulosonic acid transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
416		47518.28	9.1995

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000438	1976904	MAG	Sweden	Europe

• Gene Location: Start: 37281; End: 38531 Strand: +

Full Sequence      

MFIYEFLSTILFLISLPFYALIRACRKKFIPGWKEKMGYFKSPELGDKVIMFHGVSVGEV
IALENLVKKTKETFPDYKIVITTGTATGQEIANKKFSSIADFITYFPFDIAFCVKLFLKK
INPSAVLIAETELWPTFSFYCKKNNIPLYVINGRISDSTFKSYRLMKYFFKLFLKNYTKI
LTQSEEDKEKFLAIGSPQDRTDVMKNLKFDVKKADANIDLGQSAYRVIIAGSTHKGEDEI
VLNAFSKLKKEFPDIKLLLAPRHLQRVENVSELVKKTNLSWGLRSNKDDFKNNDIILLDT
MGELSKMYSICDFAFIGGSFNKTGGHNPLEAIVYNKPAVSGPSIHNFRDIYWILTRSKAG
KVVKTSEELTAYMHDLLADKEFYLESCNDCKTIFASQQGALENVINELDNLLYPVK

Enzyme Prediction     

No EC number prediction in MGYG000000438_01805.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT30	33	211	4.3e-56	0.9774011299435028

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05749	PRK05749	3.64e-140	1	416	3	425	3-deoxy-D-manno-octulosonic-acid transferase; Reviewed
COG1519	KdtA	7.90e-128	1	412	2	419	3-deoxy-D-manno-octulosonic-acid transferase [Cell wall/membrane/envelope biogenesis].
pfam04413	Glycos_transf_N	7.56e-68	34	211	1	176	3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase). Members of this family transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides. Members of the family transfer UDP, ADP, GDP or CMP linked sugars. The Glycos_transf_N region is flanked at the N-terminus by a signal peptide and at the C-terminus by Glycos_transf_1 (pfam00534). The eukaryotic glycogen synthases may be distant members of this bacterial family.
cd03811	GT4_GT28_WabH-like	3.78e-06	90	260	49	225	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
pfam00534	Glycos_transf_1	7.22e-06	234	383	14	148	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38189.1	4.25e-222	1	412	1	411
APG26630.1	1.39e-79	4	412	2	428
ABA88509.1	1.04e-75	3	381	4	396
AEY00398.1	8.69e-75	27	412	28	421
QBY04031.1	8.52e-74	7	408	24	436

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XCI_A	4.80e-40	27	381	28	348	Membrane-embeddedmonofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCU_A Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus]
4BFC_A	3.29e-17	226	412	43	231	ChainA, 3-DEOXY-D-MANNO-OCTULOSONIC-ACID TRANSFERASE [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AC77	2.01e-67	33	414	35	422	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli O157:H7 OX=83334 GN=waaA PE=3 SV=1
P0AC76	2.01e-67	33	414	35	422	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=waaA PE=3 SV=1
P0AC75	2.01e-67	33	414	35	422	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli (strain K12) OX=83333 GN=waaA PE=1 SV=1
P44806	7.59e-59	4	408	2	419	3-deoxy-D-manno-octulosonic acid transferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=waaA PE=1 SV=1
Q8R6G8	1.41e-54	31	416	15	411	Bifunctional glycosyltransferase/methyltransferase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355) OX=190304 GN=trmB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
2	24