CAZyme Information: MGYG000000440_00626

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS1865
• CAZyme ID: MGYG000000440_00626
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
737	MGYG000000440_2|CGC1	82283.83	5.1298

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000440	2422037	MAG	Sweden	Europe

• Gene Location: Start: 294396; End: 296609 Strand: -

Full Sequence      

MKKQFICATREVCDFSHRVPAPYLRRAFDLSFVPTRAVLSVCGLGFYRLWVNGHEITKGY
FAPYISNPDDRMYFDTYDLTSCLRQGENVLGVLLGNGFQNDFGGEVWDFDKAPWRSAPKL
ALEFHAHGDGGSLAFSADGQFLTHPSPILFDEYRLGEIYDARKESAGWNLPGFDDSDWSP
ALPADAPKGELCECLAEPIRCNETLAPVSVTPCDGGYLYDFGKNTAGTCRLHLTDATPGQ
TVVVKFCERLKDGKFDQSNLYNQPAEKYPFYYTDFARTEYRARGGDEIYEPSFAWFGYRY
AFVLGVRPEQATADLLSFPVLSSDLRRVGHFSCSDETVNRIFDLIVNSDRSNFYYFPTDC
PHREKNGWTGDASMSAPQMSLLFDTTASYLEWLRNIVAAQRADGALPGIVPTGGWGFAWG
NGPAWDSVLVNLPYTVWRLRGDTRAITLTADAMLRYFAYIRTRRSADGTVAIGLGDWVPV
GKKSSRYDTPLVLTDSIMVMDMAKKAAEMLAAIGRTEDAATAAALGDEMLAAIRASLLDS
STATLANGTQTAQAMGLYYGVFAPEERRKAFDLLLTRIRENGGDFDCGFLGLHTLFPVLS
DFGESETAYRMITQKKFPSYRNLLDRGETAMVESFQPEGGRECGSHNHHFLGDVVRWFFR
DLAGLEIIDCRHVRVRPSFVRELDSVKASYDLPGGTVSVVWQREGDRIALTVTHPADVLC
EIDRSRADCMVKEEISR

Enzyme Prediction     

No EC number prediction in MGYG000000440_00626.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	214	722	3.2e-125	0.9841269841269841
CBM67	18	186	1.7e-30	0.8920454545454546

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.62e-88	326	660	1	338	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.26e-45	34	200	3	169	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	3.30e-11	214	317	5	98	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	4.96e-10	671	734	10	75	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA24212.1	1.30e-134	20	722	155	858
QGQ94103.1	1.77e-133	19	717	141	833
QNN24933.1	2.15e-132	20	722	351	1052
QDK77891.1	3.12e-127	20	715	157	850
BBK91320.1	8.79e-127	20	722	144	845

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.55e-81	21	717	176	891	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	5.97e-78	21	722	302	992	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	2.99e-57	14	705	126	820	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	2.84e-77	21	722	302	992	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	1.33e-60	23	721	172	875	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	3.59e-57	21	728	184	910	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KNB2	1.16e-55	23	723	176	877	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000003	0.000018	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000440_00626.