CAZyme Information: MGYG000000440_01331

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS1865
• CAZyme ID: MGYG000000440_01331
• CAZy Family: CE14
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
223	MGYG000000440_6|CGC2	24648.15	5.817

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000440	2422037	MAG	Sweden	Europe

• Gene Location: Start: 138967; End: 139638 Strand: -

Full Sequence      

MNYLIVVAHPDDEVLGAGATIHKLITTGNRVAVCTMANHVAARANVSETLAEDQANAMRI
MGVSKCYTADFPNIRMNTVPHLELVQFIEWCIEDFGAEVVITHHPSDTNNDHVMTSYAAQ
AAARLFQRKSGIPPLKMFLYMEVPSSTDWSLDSTAIPFTPNYFVEIGKEGMELKIKALQA
YRGVMRDYPHPRSEEALTGLAAYRGSQAGCCYAEAFECVIQRG

Enzyme Prediction     

No EC number prediction in MGYG000000440_01331.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE14	4	107	7e-18	0.9596774193548387

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2120	LmbE	8.53e-29	1	217	11	226	N-acetylglucosaminyl deacetylase, LmbE family [Carbohydrate transport and metabolism].
pfam02585	PIG-L	2.40e-22	5	120	1	125	GlcNAc-PI de-N-acetylase. Members of this family are related to PIG-L an N-acetylglucosaminylphosphatidylinositol de-N-acetylase (EC:3.5.1.89) that catalyzes the second step in GPI biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACV67908.1	1.55e-20	1	223	341	566
AHG90496.1	4.42e-16	1	216	1	207
ATZ07896.1	3.65e-13	4	223	9	223
QNM09796.1	1.14e-12	1	216	1	218
QBO57515.1	1.87e-09	1	216	3	223

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WE7_A	1.95e-07	9	217	44	256	CrystalStructure of Diacetylchitobiose Deacetylase from Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3WE7_B Crystal Structure of Diacetylchitobiose Deacetylase from Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3WE7_C Crystal Structure of Diacetylchitobiose Deacetylase from Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3WL3_A N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3WL3_B N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3WL3_C N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii [Pyrococcus horikoshii OT3],5B2E_A N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii complexed with its inhibitor MPG (acetate-containing condition) [Pyrococcus horikoshii OT3],5B2E_B N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii complexed with its inhibitor MPG (acetate-containing condition) [Pyrococcus horikoshii OT3],5B2E_C N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii complexed with its inhibitor MPG (acetate-containing condition) [Pyrococcus horikoshii OT3],5B2F_A N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii complexed with its inhibitor MPG (phosphate-containing condition) [Pyrococcus horikoshii OT3],5B2F_B N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii complexed with its inhibitor MPG (phosphate-containing condition) [Pyrococcus horikoshii OT3],5B2F_C N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii complexed with its inhibitor MPG (phosphate-containing condition) [Pyrococcus horikoshii OT3]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P71311	2.82e-07	8	182	24	184	Uncharacterized deacetylase YaiS OS=Escherichia coli (strain K12) OX=83333 GN=yaiS PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000022	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000440_01331.