CAZyme Information: MGYG000000441_00215

Basic Information

• Species: CAG-312 sp900545705
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312; CAG-312 sp900545705
• CAZyme ID: MGYG000000441_00215
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
569	MGYG000000441_1|CGC3	62778.49	8.0385

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000441	2454454	MAG	Sweden	Europe

• Gene Location: Start: 272282; End: 273991 Strand: +

Full Sequence      

MKQFGVYCLAGLLSIAGQFCIGGENGLDKIYSPKVVGVPPADAVSGLCTMPDGKIRHYNY
GGQPENLKSGTHGEVSNRMYIESSDMGLTWTETQAPAGKEFGVYFDKSRGKYFNIINIGG
SAWFLDCGTDGECVEKTQICPWRLELNAEPLIVDGRILMPITLRTSSSQNLDFVFGAIFL
ISDDFGKTWKKSSRLNVPHHKAGGLHKGTRWNHDAMEPSAVRLKDGRLWVILRTSLDNLW
QSYSSNGGLTWSKPVPTNFYGTCVMPKIKRLSDGRLLLMWSNGTALPEVEGADGVWEDVF
TNRSAIHAAISDDDGKTWRGFREVLLDPRRNASDFSSAPGRDKSVHQSQFIEVAPGKILA
SIGQSKLNRRLVLFDVGWLLEKSRECDFSNGLQDWSVFNYKKGIKGHCAYDRIEGCGLAD
NPDSPDKKCLLLKYVPDNSLVSDLRGAVWNFPMARKGEIKLKVKIPSGFKGAKVMLHDRW
INPSDEVAENYALFSADIPESLGDGSTRELVFTFDADSGKAELSCGGKKIADCKISRKAP
IGISYLHLQTSRKSPDAGMYVLSVAENGF

Enzyme Prediction     

No EC number prediction in MGYG000000441_00215.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	154	321	1.9e-21	0.40058479532163743

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	1.95e-23	154	333	155	306	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	1.51e-20	50	319	59	252	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	6.54e-11	182	372	52	227	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
cd15482	Sialidase_non-viral	6.87e-04	218	318	17	125	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEA17103.1	1.15e-151	12	561	12	550
QCQ39035.1	1.97e-149	1	561	1	556
QCQ42527.1	1.97e-149	1	561	1	556
QCQ56765.1	3.93e-149	1	561	1	556
AKA52559.1	3.93e-149	1	561	1	556

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.074463	0.915790	0.009034	0.000256	0.000217	0.000230

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000441_00215.