CAZyme Information: MGYG000000441_00806

Basic Information

• Species: CAG-312 sp900545705
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312; CAG-312 sp900545705
• CAZyme ID: MGYG000000441_00806
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
479		55507.94	8.3818

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000441	2454454	MAG	Sweden	Europe

• Gene Location: Start: 198998; End: 200437 Strand: -

Full Sequence      

MNTKFFRFFFVFCATIASYSGYGDGFVRVSERNPNYFELSDSSVYIPLGYNLSFPRFWDK
LSEEESFAMVEKHLKNIAENGGNYARIWISHPFYEIEDSRPGVYNPKKFARIDRLVGLAQ
KYGVRLKICLEHFRNIRKYRPAENESGLQTHIFQRPAYAGEFANMKEYFSSQKGRDLFFN
RFEALFKKYSDNPIIFAWELWNEQNTVQADAKVVKEWEKYMFKRMGEVCKNQMIVNSYGS
LDSDSSKKAYKFYYNDSSNMIAAVHRYLDEGAAYDVCHGPVDLAAADAIKEIKEMYPEHP
ALLAETGAVQPKHSGPWRYYDADTDGIIFHDALYTPFFCGSAGGGQPWHWDVYIYKHELW
RHLKPFSALLEKIDPRDENFKPFRADTKKLRVYALDGKKTLLAFARDIDNNWVNEFEKGI
KPSEISGEKIDFTNAVKGRKISKVRVYDLWGGAVNSAEPSAKVSLPPFKRSCAVRIDFE

Enzyme Prediction     

No EC number prediction in MGYG000000441_00806.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	65	325	1.7e-20	0.6836363636363636

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11309	14-3-3_fungi	0.001	194	303	59	168	Fungal 14-3-3 protein domain. This family containing fungal 14-3-3 domains includes the yeasts Saccharomyces cerevisiae (BMH1 and BMH2) and Schizosaccharomyces pombe (rad24 and rad25) isoforms. They possess distinctively variant C-terminal segments that differentiate them from the mammalian isoforms; the C-terminus is longer and BMH1/2 isoforms contain polyglutamine (polyQ) sequences of unknown function. The C-terminal segments of yeast 14-3-3 isoforms may thus behave in a different manner compared to the higher eukaryote isoforms. Yeast 14-3-3 proteins bind to numerous proteins involved in a variety of yeast cellular processes making them excellent model organisms for elucidating the function of the 14-3-3 protein family. BMH1 and BMH2 are positive regulators of rapamycin-sensitive signaling via TOR kinases while they play an inhibitory role in Rtg3p-dependent transcription involved in retrograde signaling. 14-3-3 domains are an essential part of 14-3-3 proteins, a ubiquitous class of regulatory, phosphoserine/threonine-binding proteins found in all eukaryotic cells, including yeast, protozoa and mammalian cells.
pfam00150	Cellulase	0.005	77	269	33	197	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL08912.1	6.41e-115	26	478	32	469
BBL11704.1	6.41e-115	26	478	32	469
BBL00987.1	6.41e-115	26	478	32	469
AEI51976.1	5.52e-112	24	477	27	474
AXE20299.1	2.78e-109	26	477	29	474

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.048070	0.947287	0.003744	0.000290	0.000276	0.000295

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000441_00806.