CAZyme Information: MGYG000000441_01477

Basic Information

• Species: CAG-312 sp900545705
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312; CAG-312 sp900545705
• CAZyme ID: MGYG000000441_01477
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366	MGYG000000441_11|CGC1	40097.33	9.7659

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000441	2454454	MAG	Sweden	Europe

• Gene Location: Start: 18044; End: 19144 Strand: -

Full Sequence      

MSKFIILCGGTGGHLAPGLAVGQALIDAGNEASFVISQKEVDSRLVRKYSNLHIIKAPGV
AFSLNPARFCKFLSELAKSVRFGRKVISEGKYDAVISFGGFNSLGFSIAARTLGIPLILH
EANRRAGKATRLLGRFAERIYVPYGVRIPRRKGGQVKYSGYPVRSEIKKLPKGECRRKFG
FTDGGKLLLVLGGSQGALALNEWAFHNFDRLAEKGINVLCVCGQGKKIFSDRTVSTKEFG
DKKISFLEFCDDMASAMSAADVAVARAGAGTIAELARCRLPSVIVPYPFAADNHQRENAR
CFEKQGGCAVIEQDDLNRLFDEVIWLMENEGLRRTMEENLARVDALNDTSKIIDDLKEIA
RKTEVG

Enzyme Prediction     

No EC number prediction in MGYG000000441_01477.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	188	342	5.6e-45	0.9490445859872612

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03785	GT28_MurG	2.85e-95	3	354	1	349	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK00726	murG	8.62e-89	1	362	1	357	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
COG0707	MurG	1.41e-74	3	362	2	357	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	3.73e-71	2	353	1	344	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam04101	Glyco_tran_28_C	1.36e-30	194	317	8	129	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYY35776.1	8.01e-109	1	360	1	360
AWT60195.1	2.72e-96	1	360	1	361
ADE56085.1	1.20e-95	1	366	1	366
AOS46406.1	3.18e-95	1	360	1	360
SDR67047.1	4.09e-93	1	363	1	363

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D1I_A	1.25e-28	5	354	13	360	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
1F0K_A	2.34e-28	3	364	8	358	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
3S2U_A	1.12e-26	5	364	6	359	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
4WYI_A	7.47e-07	155	362	179	386	Thecrystal structure of Arabidopsis thaliana galactolipid synthase, MGD1 (apo-form) [Arabidopsis thaliana],4X1T_A The crystal structure of Arabidopsis thaliana galactolipid synthase MGD1 in complex with UDP [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B1ZU31	8.29e-88	1	361	1	361	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1) OX=452637 GN=murG PE=3 SV=1
A9FI55	5.78e-41	1	361	1	361	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Sorangium cellulosum (strain So ce56) OX=448385 GN=murG PE=3 SV=1
A3DE27	1.47e-40	3	366	2	369	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=murG PE=3 SV=1
Q0AYQ8	2.82e-39	3	354	2	359	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) OX=335541 GN=murG PE=3 SV=1
A1SU19	3.06e-39	5	356	8	354	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000441_01477.