CAZyme Information: MGYG000000441_01844

Basic Information

• Species: CAG-312 sp900545705
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312; CAG-312 sp900545705
• CAZyme ID: MGYG000000441_01844
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391	MGYG000000441_18|CGC1	43041.34	9.4611

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000441	2454454	MAG	Sweden	Europe

• Gene Location: Start: 6436; End: 7611 Strand: -

Full Sequence      

MNPDVLKMRSFRFAAPADGRCDLLVIAGEHSGDEQSARMVSDALKLNPNLKICAFGGEKL
SECGAQLLFDMTSFSVVGLVEVLKNYGFFKKLSEAVVDWIGKYRPKAVCFVDYPGFNLHI
ASILKQRGISQRGGGSVKLLYYISPQIWAWKASRRFKMAELLDSLAVIFPFETKCYADTN
LDTHFVGHPFLSDSYQPPVVYDPAGEILLLSGSREIAVSRIFPVMCGALEKIDGAKAVAI
YPTERIKNILEKEISRRPILKDRVRIVPNGGSSALAAKAVMMSSGTMSLACSLQGIPGAI
VYKANPFTYFVGRALVKIKYLSIANILLDKPAWREFIQFDASAAPLAEYMQDCLKPSARK
NFAEYAKTLKGLLHSPPSLSAAQWLCLKGGF

Enzyme Prediction     

No EC number prediction in MGYG000000441_01844.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	24	366	1.6e-85	0.9717514124293786

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.09e-80	23	371	4	361	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	9.56e-75	24	383	5	373	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	4.51e-65	23	348	1	333	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.04e-52	23	348	8	339	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	4.00e-45	68	385	42	344	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYY34968.1	1.17e-134	17	391	6	382
ATC65221.1	2.52e-133	13	385	10	378
AKC82833.1	4.53e-132	11	390	9	384
QXD30622.1	8.70e-132	1	385	1	388
AHF91230.1	7.67e-127	11	385	10	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	2.96e-31	23	347	9	338	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	2.96e-31	23	347	9	338	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A9KC41	4.11e-59	23	379	6	357	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1
B6J161	4.11e-59	23	379	6	357	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
Q83DS5	5.78e-59	23	379	6	357	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) OX=227377 GN=lpxB PE=3 SV=1
A9NCA7	5.78e-59	23	379	6	357	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) OX=360115 GN=lpxB PE=3 SV=1
B6J9H1	1.60e-58	23	379	6	357	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuK_Q154) OX=434924 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000441_01844.