CAZyme Information: MGYG000000442_00463

Basic Information

• Species: CAG-462 sp003489705
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-462; CAG-462 sp003489705
• CAZyme ID: MGYG000000442_00463
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
486	MGYG000000442_4|CGC2	52910.89	6.0821

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000442	3125088	MAG	Sweden	Europe

• Gene Location: Start: 41413; End: 42873 Strand: -

Full Sequence      

MKNSIILACGLLLAASVAGAQGLKTYPTPDRSAVPAFPGADGAGKYTTGGAGGKVYTVTS
LADDGSEGTLRWAIRKEGPRTIVFAVSGIIELTEPLKINHGDLTIAGQTAPGDGICLKNY
TLGVSADNVIIRFIRSRMGADIKQKGDDAMNGFTGHRNIIIDHCSMSWSTDECATFYDNR
DFTLQWCIVSESLANSIHEKGKHGYGGIWGGQTASFHHNLLAHHTNRTPRLCGSRYTGKP
EEERVELFNNVIYNYGSAYAGEGGSYNFLNNYYKPGPYTSLKASCNRLFTAYADDGKNEN
KKGTHGVFYFKGNYIDPTCDRLTEKKRKAILKVNEDNTAGLVVKDDFAPKSELLAAEAFD
IAEHTTLQPTWDAYESVLLHAGASYKRDKHDARIVDEVRRGTYTYEGSHGSTLGIIDQPS
DVGGWGEYRSMPAPADTDGDGMPDEWEKAHGLNQSDPADGAIYNLNPHYTNLEVYLNELV
SGAFPA

Enzyme Prediction     

No EC number prediction in MGYG000000442_00463.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	87	273	3.5e-76	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3866	PelB	4.45e-08	23	276	17	280	Pectate lyase [Carbohydrate transport and metabolism].
smart00656	Amb_all	1.09e-05	95	265	11	175	Amb_all domain.
pfam18884	TSP3_bac	0.001	436	459	1	21	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ55765.1	1.01e-278	1	485	1	496
SCV08373.1	1.01e-278	1	485	1	496
QGT73501.1	1.01e-278	1	485	1	496
ALJ48955.1	1.01e-278	1	485	1	496
QDM11671.1	8.30e-278	1	485	1	496

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8NQQ7	6.90e-50	32	484	18	418	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
Q2UB83	5.12e-48	32	484	18	418	Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyC PE=3 SV=1
Q5B297	5.35e-48	32	484	18	415	Probable pectate lyase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyC PE=3 SV=1
Q4WL88	1.03e-45	32	484	19	419	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
B0XMA2	1.43e-45	32	484	19	419	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000286	0.999000	0.000181	0.000181	0.000168	0.000148

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000442_00463.