CAZyme Information: MGYG000000442_01057

Basic Information

• Species: CAG-462 sp003489705
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-462; CAG-462 sp003489705
• CAZyme ID: MGYG000000442_01057
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
599	MGYG000000442_10|CGC1	68675.29	7.3736

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000442	3125088	MAG	Sweden	Europe

• Gene Location: Start: 11716; End: 13515 Strand: +

Full Sequence      

MKILRRWLCIGLLACLPICLQAQTSDSYFLHTIARGENLTSIAATYNVSVADIVRLNPGS
DRFIKAGETLRIPQSKDNNGPQYHTIQPGETLYGLMKRYDVTVEAICKANPGLSESNFRS
GQVIIIPAADKTADLPIIQSDQPASQSVVIPQQSYRDIHKVKRRETIYSICREYGITEEE
LIAANPELKTEKLKRGKYIRIPFHKQMPVAPVVTPGESAMPTNSELFERINSDTKRKNQL
KVAVMLPFMLNGGNQGEQMRMVEYYQGVLMAINELKKNGTSFDIHTYDTQNNATTVRQIL
ARSEMKDMDLIIGPGHATHIPAISAFSEQNKIRLVVPFTSKCDEVFGNPYLYQVNTPQSY
LYSEVYEHFLRKFRGNNIIFVDAGDGETDKREFIGGFKQELKDQHIPFREINANSKESIE
QALQAGTENILIPTSGSNIALIKLLPYLKALKLSWEAEETPDKYSLHLFGYPEWQTYTTD
HLDDFYTFDTYFYTSFYANNLSVSVVNFQKEFRQWYHKEILNTYPKYAILGYETAHYLLK
GLSLYGNKLEQHLNNIQVTPIQTSFRFERVSNWGGFINKKVFFIHFTKDHELIKMDFDQ

Enzyme Prediction     

No EC number prediction in MGYG000000442_01057.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06268	PBP1_ABC_transporter_LIVBP-like	2.53e-12	241	539	1	287	periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type 1 periplasmic binding fold protein superfamily. Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type 1 periplasmic binding fold protein superfamily. They are mostly present in archaea and eubacteria, and are primarily involved in scavenging solutes from the environment. ABC-type transporters couple ATP hydrolysis with the uptake and efflux of a wide range of substrates across bacterial membranes, including amino acids, peptides, lipids and sterols, and various drugs. These systems are comprised of transmembrane domains, nucleotide binding domains, and in most bacterial uptake systems, periplasmic binding proteins (PBPs) which transfer the ligand to the extracellular gate of the transmembrane domains. These PBPs bind their substrates selectively and with high affinity. Members of this group include ABC-type Leucine-Isoleucine-Valine-Binding Proteins (LIVBP), which are homologous to the aliphatic amidase transcriptional repressor, AmiC, of Pseudomonas aeruginosa. The uncharacterized periplasmic components of various ABC-type transport systems are included in this group.
cd00118	LysM	1.25e-10	82	126	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
cd00118	LysM	1.20e-09	31	72	3	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
PRK06347	PRK06347	1.45e-09	24	201	401	591	1,4-beta-N-acetylmuramoylhydrolase.
pfam01476	LysM	2.93e-09	84	127	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALA74972.1	4.63e-227	1	598	1	602
QJR68229.1	2.65e-226	1	598	1	602
QJR60047.1	2.65e-226	1	598	1	602
AII69224.1	2.65e-226	1	598	1	602
QJR72564.1	2.65e-226	1	598	1	602

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4B8V_A	1.48e-07	25	202	38	217	ChainA, Extracellular Protein 6 [Fulvia fulva],4B9H_A Chain A, Extracellular Protein 6 [Fulvia fulva]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P44493	1.73e-10	26	201	289	429	Probable N-acetylmuramoyl-L-alanine amidase AmiB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=amiB PE=3 SV=1
Q49UX4	2.36e-07	25	185	23	178	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=sle1 PE=3 SV=1
Q9P403	1.11e-06	17	127	100	228	Intracellular hyphae protein 1 OS=Colletotrichum lindemuthianum OX=290576 GN=CIH1 PE=1 SV=1
Q2G0D4	2.09e-06	31	110	29	117	Probable autolysin SsaALP OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_00671 PE=1 SV=1
O05495	2.37e-06	29	128	2	94	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001144	0.793138	0.204810	0.000329	0.000296	0.000261

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000442_01057.