CAZyme Information: MGYG000000442_01501

Basic Information

• Species: CAG-462 sp003489705
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-462; CAG-462 sp003489705
• CAZyme ID: MGYG000000442_01501
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
306	MGYG000000442_16|CGC1	35701.59	9.6048

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000442	3125088	MAG	Sweden	Europe

• Gene Location: Start: 15836; End: 16756 Strand: +

Full Sequence      

MVVKKTLEAENKPERKPRRPKSSVSGQSRKPRQKAAVRQKRNVAKKAQPKKRLWGETPRW
LIWAVTGVVAMAYLCFVYVYYLKPYFYRWDFGDTYAGRPVVHGIDISHHQGEIDWEKLAK
AEHTGSGIHFVFMKATEGSDWVDSAFQQNFAKARENGFIRGAYHFFSNTSPAEKQADFFC
DHVELLADDLPPVLDVETRGDYGEDSLRLEVKTWLKRVEKHYGVKPIIYASRKFKERFLN
DDSLDAYPFWIAHYYVDSLTYQGEWAFWQHTDMGRLPGIHGRVDMNVFNGDLEALRQFTI
RPQEKP

Enzyme Prediction     

No EC number prediction in MGYG000000442_01501.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	104	279	2e-54	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06524	GH25_YegX-like	4.20e-82	102	290	1	194	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.
cd06413	GH25_muramidase_1	4.07e-69	101	290	3	191	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd00599	GH25_muramidase	1.54e-64	102	288	1	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	2.13e-58	104	279	1	180	Glycosyl hydrolases family 25.
COG3757	Acm	3.92e-51	100	298	62	263	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO25286.1	2.33e-96	56	300	38	288
ADY35571.1	1.53e-95	36	302	33	305
QKH87185.1	4.15e-94	31	301	15	285
QCQ33546.1	4.15e-94	31	301	15	285
AUI47123.1	4.15e-94	31	301	15	285

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAG_A	4.29e-38	98	301	13	219	TheStructure of a family 25 Glycosyl hydrolase from Bacillus anthracis. [Bacillus anthracis str. Ames]
1JFX_A	1.88e-29	101	295	5	209	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
4KRU_A	1.95e-27	103	292	22	211	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	2.05e-26	103	292	22	211	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
5A6S_A	8.62e-20	105	291	26	204	Crystalstructure of the CTP1L endolysin reveals how its activity is regulated by a secondary translation product [Clostridium phage phiCTP1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P76421	3.09e-56	90	306	44	272	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
Q8FFY2	3.09e-56	90	306	44	272	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2
Q8X7H0	1.73e-55	90	306	44	272	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2
P25310	5.71e-28	101	295	82	286	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
P26836	3.37e-24	103	292	11	200	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999712	0.000286	0.000001	0.000000	0.000000	0.000002

TMHMM  Annotations     

start	end
60	82