CAZyme Information: MGYG000000442_01836

Basic Information

• Species: CAG-462 sp003489705
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-462; CAG-462 sp003489705
• CAZyme ID: MGYG000000442_01836
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321	MGYG000000442_21|CGC1	36376.04	7.1068

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000442	3125088	MAG	Sweden	Europe

• Gene Location: Start: 32753; End: 33718 Strand: +

Full Sequence      

MKKLYTLLVSLLVCAAAAAATDTPDTLVVARDGSGKFRTLWEAIEDCRAFMDYHKVIFVK
RGTYKEKVIIPSWLTNIEILGEDRDETIITYDDHANIRLADHDAPMGTFRTYTVKVEGSD
ITFRNITIENNAAQKGQAVALHTEGDRLKFVNCRILGNQDTIYTGVAGTRLYFEDCYIDG
TTDFIFGPSTAWFERCTLHSKRDSYVTAASTPQDVKYGYVFNHCRLTADPSVKRVCLGRP
WRPYAYTLFMNCELGSHIVAKGWHNWNKASNEQTARYAEYNNTGAGANTTERAPWSRQLT
KKEAAEVTLEAVFTREDTWRP

Enzyme Prediction     

No EC number prediction in MGYG000000442_01836.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	27	313	1.2e-101	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	6.05e-76	28	308	3	290	Pectinesterase.
PLN02773	PLN02773	3.98e-74	27	321	7	303	pectinesterase
COG4677	PemB	3.19e-65	56	313	114	402	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02682	PLN02682	1.42e-62	26	304	70	352	pectinesterase family protein
PLN02432	PLN02432	4.73e-59	27	305	13	278	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQY38333.1	3.19e-167	1	321	1	314
ALK82867.1	3.19e-167	1	321	1	314
QEW38158.1	3.19e-167	1	321	1	314
ABR39474.1	3.19e-167	1	321	1	314
ALA73615.1	4.53e-167	1	321	1	314

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	2.77e-42	27	295	9	281	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	1.15e-39	28	295	6	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	1.32e-35	27	292	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	7.04e-35	27	292	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	2.52e-31	23	321	3	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	3.45e-55	29	304	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
P41510	2.23e-49	26	307	272	558	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q42608	3.60e-47	26	307	259	545	Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris OX=3711 PE=2 SV=1
Q5MFV6	6.32e-47	26	307	276	562	Probable pectinesterase/pectinesterase inhibitor VGDH2 OS=Arabidopsis thaliana OX=3702 GN=VGDH2 PE=2 SV=2
Q8GXA1	1.28e-45	28	321	259	558	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000296	0.999012	0.000187	0.000168	0.000149	0.000142

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000442_01836.