CAZyme Information: MGYG000000443_01126

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Eubacterium_R
• CAZyme ID: MGYG000000443_01126
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
641		73669.16	5.4251

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000443	1708212	MAG	Sweden	Europe

• Gene Location: Start: 4493; End: 6418 Strand: -

Full Sequence      

MFKLSSNRLKREFKITDGKFYASQIKNTYSGMSFVPDGNGNEFVVHFVDGGEYSSKGLPV
EYSDYEDDKLVFRFAETDGLQVTLKYWVHNDGNTVCKQIFIDQTDDRVVDFIELENVGII
NSKTHFDVSVVEGGEIPAFWSMLGQPIYIDSLFFGCEFPATENRIIHGSASVRYFVGHAL
GKGFVCPVTVMGGGSDNTLPSVRKAFYEYIESISVPTTLRFQYNSWYDYMKDITEQNIMT
SFAEVHKQLQAYGAPDLAAYVVDDGWPNVKASFWSFNKKFPNKLTNVTALCNEMGSKFGL
WLGPRGGYTRPDKIAKRYQRAGNGYLNKESHEICVASSKYVEKLGDFLVETTNEFDIDYW
KLDGFCLKACNNPKHDHAIGGYEDMYFVTDMWQKWIQLYNKLRSANPNLWINMTCYVNVS
PWWLQWVNSIWVQNSADIGFAKNLENQAQVDKEITYRDGRYFDCLCKRALQIPLKNLYNH
EPIYGNTAKVSYTDEEFERYIYWCTVRGQALNELHLSVNMMNDSKWRSLSAAMNWQKANY
HILQNAQFIGGDPVENNIYGYISWDGDEGVIALRNPTDEETSLTLTLNKLMGAPESLQGA
RRFNVYCKSLAETDETYSYNSKMELTMKPFESMIFKIAKER

Enzyme Prediction     

No EC number prediction in MGYG000000443_01126.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	3.56e-11	223	411	6	194	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
COG3345	GalA	7.29e-07	184	304	253	377	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd14792	GH27	3.11e-05	223	385	5	141	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam02065	Melibiase	4.20e-04	184	304	2	126	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT26415.1	1.61e-141	4	638	38	725
QDO70357.1	2.50e-138	9	638	43	725
AMN35790.1	4.41e-124	54	639	304	917
ATD48595.1	4.41e-124	54	639	304	917
SQI04569.1	8.42e-124	54	639	304	917

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000443_01126.