CAZyme Information: MGYG000000444_00306

Basic Information

• Species: Borkfalkia ceftriaxoniphila
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; Borkfalkia; Borkfalkia ceftriaxoniphila
• CAZyme ID: MGYG000000444_00306
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1414	MGYG000000444_4|CGC1	152359.48	4.2171

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000444	2535942	MAG	Sweden	Europe

• Gene Location: Start: 14313; End: 18557 Strand: +

Full Sequence      

MAKISRVGKKRAFRAFACATMLALGLSCLSSPILSVGAEVMGAKGMTKYYADYDSLEETL
SAAEQLTEDTAAEGDVLLKNQNKALPMRGNEWISVFGVSADSLIGAAPTGGQSTASAGGD
KVADVLADAGFKVNPTLKNFYDNQSATIGQEEYAFNGKVTSSFSMYSDAAVVVLARTGGE
GSDAKRVTSEEAGTNLLDEKDTASHVALAEKDGKTYKHYLMLTDSERALIKMVEEKFDKV
VVVLNTSNAMEIEELRDDENIDAIINIDRPGEGGLAALGKILKGDINPSGGLVDEWYTDF
TADPTWYNFGNNDQKGSKGAGSNTYMNEAGSSAGTTEGADGTTTDVISDTEGFHGIDYEE
GIYLGYKYYETYYHDMYQIDADAAQQWWEENVTYAFGYGLSYTTFSFKSNGIYTDSALKN
KLTAADQKTIASQLQSTYQKAAAVDTLYLPVTVTNTGSVAGKKTVQVYVSAPYETDSVVE
KASVSLVGFAKTGILDPGESQTVVVSVNVQDMASWYSYYAQSDKVTKGAYIMESGEYTLR
IMEDSHYDCSTVEKDGKYYVTDSEGVERAECYAEESFTLEQDIALEKDDYSGLQVSSLFT
DGVNNNGEGMDKDTAVDESHFGNIRTKAMMKDQASGMTTMTRNASVSATDPSVVVKNDKN
VASASIVNYTGVSVPTKPSEVKSTVNGFDLSFPKAPTAADLTFKDNVLDNWSYWDNYAVS
STYTGANDATKTYNKYYENDDDKGYVWSHTSVPTDWSQAKGTLGEYTNAGANGDKGAQKI
KFYASSSSVNTIKFSDMAGADYNDEKWTEFLNQLTYDELCQVNTYCGYGTVNIDSVGKKV
TVDRDGPNSINQEFQACAESLQAATWNTELAEKRGIIIGNIALITGFQGWYAPGADIHRS
PFSGRNNEYFSQDGILGGYIGAALTQGVQSKGIICYAKHTLMNDQETDRGCLFTWCDEQA
MRENYMKNFQMIFQEGGSQAGMTAYGRLAGKANTNNTNLSVELYQNEWGSHAYFVTDGYI
GWNQRTNPDIMVRAGAQTILTTGNTEYLSGQTDPTTGEQPTGGFYKQGETLPDGKTAETE
GVYIVQKGEDGKTYYEISYTQWYCVREMAHNVLYQVANSAGQFNGYGDLELDNGKLEATE
SLSVSNVSVSIESKLDKDSTVRYSLTGALPEGLTFDENTGTISGTPKESGTFNLTVNYVI
DGWINKSATYVLTVDTAIQITAESSNFTEAAVGTEFYAEFTSDVYTSAEYNSITYSLKEG
SSLPDGLTLNADGTITGSPEKAGTYTFTVVLTAKNEESGTNPAATPFAEGGDKGDGGKGD
GGKGDGGNKDKTAETTFVIVVKGETTGGDTDITIEDLNDKISDLESTIKDLQNSLEGNTS
SGCGSSVTGGAALVGAVVLLGATICMVVSRKKKN

Enzyme Prediction     

No EC number prediction in MGYG000000444_00306.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	859	1019	6.8e-34	0.7407407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	5.55e-21	51	545	374	754	beta-glucosidase BglX.
PLN03080	PLN03080	1.13e-15	65	508	393	743	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	7.98e-15	76	297	2	190	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam14310	Fn3-like	1.34e-13	464	545	2	71	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.
pfam05345	He_PIG	9.89e-06	1156	1214	31	94	Putative Ig domain. This alignment represents the conserved core region of ~90 residue repeat found in several haemagglutinins and other cell surface proteins. Sequence similarities to (pfam02494) and (pfam00801) suggest an Ig-like fold (personal obs:C. Yeats). So this family may be similar in function to the (pfam02639) and (pfam02638) domains. This domain is also found in the WisP family of proteins of Tropheryma whipplei.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEU80230.1	9.17e-141	29	1218	13	1012
QOS39237.1	1.66e-130	16	1293	6	1130
VEU80232.1	9.61e-125	40	1128	57	919
AYV69401.1	2.43e-111	63	1120	61	912
AYV72215.1	8.68e-111	63	1120	61	912

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WUG_A	1.61e-39	71	1034	44	772	Expression,characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii],5WVP_A Expression, characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
2X40_A	7.13e-26	805	1040	2	261	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	6.56e-25	805	1040	2	261	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
7MS2_A	5.15e-19	809	1017	7	231	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.28e-14	863	1017	78	232	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P16084	1.70e-48	65	1017	30	769	Beta-glucosidase A OS=Butyrivibrio fibrisolvens OX=831 GN=bglA PE=3 SV=1
P15885	3.15e-37	72	1034	18	719	Beta-glucosidase OS=Ruminococcus albus OX=1264 PE=3 SV=1
P27034	8.78e-20	809	1019	4	224	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
Q5B6C7	6.06e-19	845	1019	46	227	Probable beta-glucosidase H OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglH PE=3 SV=2
Q5BB53	1.06e-18	845	1019	45	227	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001870	0.857063	0.140194	0.000364	0.000261	0.000221

TMHMM  Annotations     

start	end
12	34
1387	1409