CAZyme Information: MGYG000000444_00879

Basic Information

• Species: Borkfalkia ceftriaxoniphila
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; Borkfalkia; Borkfalkia ceftriaxoniphila
• CAZyme ID: MGYG000000444_00879
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
509		58320.18	6.372

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000444	2535942	MAG	Sweden	Europe

• Gene Location: Start: 20164; End: 21693 Strand: -

Full Sequence      

MPKKTTADVKKTKKKDFETVAEISAPATVPEIEVTPKKKILFVASESTPFIATGGLAEVI
GSLSRALAKNSDLDVRVVIPLYSDIATEYRSKMKYLGNIFVPLAWRNQYCGIFSYEKEGV
IFYFLDNEYYFKRPGCYGYYDDGERFAFFSRSVLEIMPFLGFFPDVLHCHDWQAALAAVY
LKTIYCFRPEYQFIRSLFTIHNIEYQGKYSLDILEDLFGISNSWRYLLEYDKCINLMKAA
IECSEKFSTVSPRYAEEIKDPFYAHGLDPIVRRNEFKLTGILNGIDVDSYNSETDPAIFC
NYTKEDPEPKKRCKEELQKMFNLPVKAETPIVAVISRLVSHKGLDLVKTVIEEILRQDVQ
VIILGKGDSMYENFFTDLAKNYVGKLVTVIAFNPDLSRKIYAGADLFLMPSKSEPCGLSQ
MIACRYGTVPVVRETGGLYDSIKPVSLGGNGFTFANYNAYDMLYVIREAIACYQNKEFWP
ELVKRVMNSDFSWQRSAGEYEKLYRSMLQ

Enzyme Prediction     

No EC number prediction in MGYG000000444_00879.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	39	505	9.7e-169	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0297	GlgA	0.0	39	509	2	480	Glycogen synthase [Carbohydrate transport and metabolism].
TIGR02095	glgA	0.0	39	506	2	472	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK00654	glgA	0.0	39	508	2	464	glycogen synthase GlgA.
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	39	506	1	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK14099	PRK14099	4.88e-102	39	508	5	480	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNO18264.1	1.48e-180	39	509	2	473
BCI60006.1	1.53e-180	39	507	2	472
QAT49200.1	2.17e-180	39	509	2	473
QEY34691.1	2.97e-178	39	509	2	473
ASB40510.1	2.33e-177	39	509	2	474

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3D1J_A	7.00e-84	39	504	2	473	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	8.71e-84	39	504	2	473	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	6.73e-83	39	504	2	473	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
4HLN_A	9.60e-75	21	504	110	622	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]
1RZU_A	1.33e-73	40	508	3	476	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZU_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4J4I4	5.01e-161	39	508	2	475	Glycogen synthase OS=Desulfotomaculum reducens (strain MI-1) OX=349161 GN=glgA PE=3 SV=1
A4IS20	8.88e-158	39	509	2	476	Glycogen synthase OS=Geobacillus thermodenitrificans (strain NG80-2) OX=420246 GN=glgA PE=3 SV=1
O08328	3.57e-157	39	509	2	476	Glycogen synthase OS=Geobacillus stearothermophilus OX=1422 GN=glgA PE=3 SV=1
Q97GX6	8.20e-154	39	508	2	477	Glycogen synthase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=glgA PE=3 SV=1
Q6HC18	9.06e-153	40	509	3	476	Glycogen synthase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) OX=281309 GN=glgA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000444_00879.