CAZyme Information: MGYG000000445_01169

Basic Information

• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; RUG410
• CAZyme ID: MGYG000000445_01169
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
714		82366.05	5.9498

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000445	1525621	MAG	Sweden	Europe

• Gene Location: Start: 4788; End: 6932 Strand: -

Full Sequence      

MQKLQELAESAGISSSYVDKTGITHYTTDDVRRFFLKNMGYFAETETEIEMSLKILRKQR
LLPFVMSFFEDEKIEFVINGDEKYELLLKDEKQNIIQTKFVSGRQKICLSGLNSGYYNLI
LRNENLQCESFLIYAPKKCWQPTFLLEKEHIFGTAVMLYALHSEHSMGIGDFGDLAEIVK
LTAQNGGDAVGVNPLGVMSPFTQNEERFATGRQSDVSPYRTLSRLFVNYIYLDLPAEEDF
TNSSLVQAYMNLPETKTEIERLNAGNKVEYAAVLLLKKQILEMMFHHFETTASEKRKNEF
YAYIKEKGTELENLAIFETLLEINEPADYWRFWPEAYQNVDSAEIKAFTRKYQAKIKFYQ
YCHWLADKQIKQVQNLALSLGMKLGLYTDMPIGAASNGAEVWENPKAYVLEAGVGAPADP
MRPRGQSWGFTPYHPQRLMAQYYAPFIKLVQENMQYSGALRIDHAMGLQRLFWGFFTADN
PVVQGAYVYYNIKDLVAILCLESNRHKCLVIGEDLGTVPDGFREYMAEHNLLSYKVFCRQ
KEKNGSFIAPEKYMYLSLAQPSTHDQATACGFWQNEDIEVFNRSGLYVNEKQYSDNLEGR
RSDRKNMLKAFEQQQILTPVERQEMSDSMVDGNFAPIHIELKINEYCAKTNSAVFLVRLN
DIYRQKVLDNAPGTVQEYPNWRIKMSVSVEQIKQSLEFAEMMRLIKANRPHKGE

Enzyme Prediction     

No EC number prediction in MGYG000000445_01169.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	157	705	7.1e-120	0.9838056680161943

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11052	malQ	0.0	1	706	3	683	4-alpha-glucanotransferase; Provisional
PRK14507	PRK14507	7.79e-170	1	710	5	722	malto-oligosyltrehalose synthase.
pfam02446	Glyco_hydro_77	8.38e-128	158	688	3	460	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
COG1640	MalQ	4.13e-119	139	692	1	499	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
PRK14510	PRK14510	6.57e-111	149	712	722	1221	bifunctional glycogen debranching protein GlgX/4-alpha-glucanotransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZQ84021.1	1.94e-128	1	712	29	756
QDP02798.1	7.24e-127	1	710	1	724
QKS53657.1	1.78e-126	114	710	1282	1861
QWA11627.1	2.90e-126	4	703	6	682
QOL26808.1	2.76e-125	1	710	1	720

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3P_A	1.25e-119	2	692	4	670	AmylomaltaseMalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3P_B Amylomaltase MalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3Q_A Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_B Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_C Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12]
4S3R_A	4.16e-112	2	690	4	668	AmylomaltaseMalQ from Escherichia coli in complex with the pseudo-heptasaccharide acarviosine-glucose-acarbose [Escherichia coli K-12]
5B68_A	2.15e-56	4	711	7	709	Crystalstructure of apo amylomaltase from Corynebacterium glutamicum [Corynebacterium glutamicum],5JJH_A Crystal structure of amylomaltase from Corynebacterium glutamicum [Corynebacterium glutamicum]
1X1N_A	2.15e-10	330	692	184	507	Structuredetermination and refinement at 1.8 A resolution of Disproportionating Enzyme from Potato [Solanum tuberosum],6LX1_A Potato D-enzyme complexed with Acarbose [Solanum tuberosum],6LX2_A Potato D-enzyme complexed with CA26 [Solanum tuberosum]
7COV_A	2.33e-10	330	692	236	559	PotatoD-enzyme, native (substrate free) [Solanum tuberosum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45176	4.48e-121	4	686	10	674	4-alpha-glucanotransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=malQ PE=3 SV=1
P15977	6.46e-119	2	692	4	670	4-alpha-glucanotransferase OS=Escherichia coli (strain K12) OX=83333 GN=malQ PE=1 SV=2
P9WK22	1.33e-69	4	686	8	688	4-alpha-glucanotransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=malQ PE=3 SV=1
P65337	1.33e-69	4	686	8	688	4-alpha-glucanotransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=malQ PE=3 SV=1
P9WK23	1.33e-69	4	686	8	688	4-alpha-glucanotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=malQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000445_01169.