CAZyme Information: MGYG000000446_00481

Basic Information

• Species: UMGS1045 sp900547995
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; UMGS1045; UMGS1045 sp900547995
• CAZyme ID: MGYG000000446_00481
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381		45478.54	6.1345

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000446	1423737	MAG	Sweden	Europe

• Gene Location: Start: 14907; End: 16052 Strand: -

Full Sequence      

MSNVIIKLLLYEYFNIKESDKMHKYKVCVYAISKNESTFVDRWVDSMQEADKIFVLDTGS
TDDTVDKLKTRGAVVETKVFNPWRFDNARNASLNMVDIDTDICVCTDLDEVLEKGWRQKL
EDAWNDKVTRARYNYNWKLDEKGKPIVNFYTDKIHKRCGYKWTHPVHEVLKYNKDYENII
TIDGIVLNHYPDVSKSRGSYLSLLELSVEEDPEDDRNMHYLGREYMYYQRWNECIDTLIR
HLSLKSATWRDERCASMRFISRSYQALNRYEEARMWLDKAINEAPYLRDPYIERAILEYK
QNNYKDVIKYAEEALKITNHDKTYINEVFSWDNTVYDLLSVAYFNEGKMDKALENVNLAL
EMDKDNKRLKNNKRIIENVIK

Enzyme Prediction     

No EC number prediction in MGYG000000446_00481.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02511	Beta4Glucosyltransferase	1.78e-10	26	217	1	193	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
sd00006	TPR	1.62e-09	260	361	7	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
sd00006	TPR	6.91e-06	291	373	4	75	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
TIGR02917	PEP_TPR_lipo	7.54e-05	244	366	45	158	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.
pfam13424	TPR_12	1.32e-04	252	317	1	74	Tetratricopeptide repeat.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQS58819.1	7.12e-137	22	377	1	357
AQS58818.1	3.56e-134	22	377	1	357
QNK42027.1	1.16e-131	22	381	1	361
QOX65321.1	3.70e-131	22	377	1	357
CAB1239995.1	1.55e-129	22	380	1	360

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000446_00481.