CAZyme Information: MGYG000000446_00713

Basic Information

• Species: UMGS1045 sp900547995
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; UMGS1045; UMGS1045 sp900547995
• CAZyme ID: MGYG000000446_00713
• CAZy Family: GH5
• CAZyme Description: Endoglucanase 5A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361	MGYG000000446_9|CGC1	41574.08	5.7748

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000446	1423737	MAG	Sweden	Europe

• Gene Location: Start: 12340; End: 13425 Strand: +

Full Sequence      

MKRKILIIIFLFLIIISGIFFYLSNNKRDLNNIIKNEQPNIKQDLKNDDNKIENNLDKDD
KANLNKNNLVSYNGSLKIKDNTLVNQYDEKIQLKGVSTHGIQWYGEFANESNLKTLRDKW
NANLFRVAMYTNENGYIQNKNLKEKVKEIVDIAIKLDMYVIIDWHILSDNNPNIYKEEAK
EFFKEMSALYKNAPNVIFEICNEPNGNISWESDIKPYAEEIINIIRQNSQNVIIVGTGTW
SQDVDKASLNPINDNNTMYALHFYAGTHKEDLRNKAQEALHKIPLFVSEWGVSDASGSGG
VYLNEAKKWIEFMNENNLSWASWSLSNKNESSALLLPNAPFNDIADVYLSEAGKFVKQNM
K

Enzyme Prediction     

EC	3.2.1.4	3.2.1.132

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	88	321	6.9e-94	0.9831223628691983

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.20e-70	84	329	1	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	5.10e-14	62	332	33	282	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHZ49094.1	6.09e-122	70	361	35	329
VEH78321.1	2.19e-120	70	361	55	349
ATH91857.1	2.21e-120	70	361	35	329
QAT65500.1	3.92e-120	70	361	35	329
SCA86190.1	3.92e-120	70	361	35	329

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GJF_A	2.79e-124	70	361	7	301	Ancestralendocellulase Cel5A [synthetic construct],6GJF_B Ancestral endocellulase Cel5A [synthetic construct],6GJF_C Ancestral endocellulase Cel5A [synthetic construct],6GJF_D Ancestral endocellulase Cel5A [synthetic construct],6GJF_E Ancestral endocellulase Cel5A [synthetic construct],6GJF_F Ancestral endocellulase Cel5A [synthetic construct]
1A3H_A	2.72e-121	69	361	2	298	EndoglucanaseCel5a From Bacillus Agaradherans At 1.6a Resolution [Salipaludibacillus agaradhaerens],2A3H_A Cellobiose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 2.0 A Resolution [Salipaludibacillus agaradhaerens],3A3H_A Cellotriose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 1.6 A Resolution [Salipaludibacillus agaradhaerens]
1H11_A	3.02e-121	69	361	5	301	2-DEOXY-2-FLURO-B-D-CELLOTRIOSYL/ENZYMEINTERMEDIATE COMPLEX OF THE ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHEARANS AT 1.08 ANGSTROM RESOLUTION [Salipaludibacillus agaradhaerens],1H2J_A ENDOGLUCANASE CEL5A IN COMPLEX WITH UNHYDROLYSED AND COVALENTLY LINKED 2,4-DINITROPHENYL-2-DEOXY-2-FLUORO-CELLOBIOSIDE AT 1.15 A RESOLUTION [Salipaludibacillus agaradhaerens],1HF6_A ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHAERENS IN THE ORTHORHOMBIC CRYSTAL FORM IN COMPLEX WITH CELLOTRIOSE [Salipaludibacillus agaradhaerens],1OCQ_A COMPLEX OF THE ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHEARANS AT 1.08 ANGSTROM RESOLUTION with cellobio-derived isofagomine [Salipaludibacillus agaradhaerens],1W3K_A Endoglucanase Cel5a From Bacillus Agaradhaerens In Complex With Cellobio Derived-tetrahydrooxazine [Salipaludibacillus agaradhaerens],1W3L_A Endoglucanase Cel5a From Bacillus Agaradhaerens In Complex With Cellotri Derived-Tetrahydrooxazine [Salipaludibacillus agaradhaerens],4A3H_A 2',4' Dinitrophenyl-2-Deoxy-2-Fluro-B-D-Cellobioside Complex Of The Endoglucanase Cel5a From Bacillus Agaradhaerens At 1.6 A Resolution [Salipaludibacillus agaradhaerens],5A3H_A 2-Deoxy-2-Fluro-B-D-CellobiosylENZYME INTERMEDIATE COMPLEX Of The Endoglucanase Cel5a From Bacillus Agaradhearans At 1.8 Angstroms Resolution [Salipaludibacillus agaradhaerens],6A3H_A 2-Deoxy-2-Fluro-B-D-CellotriosylENZYME INTERMEDIATE COMPLEX OF THE Endoglucanase Cel5a From Bacillus Agaradhearans At 1.6 Angstrom Resolution [Salipaludibacillus agaradhaerens],7A3H_A Native Endoglucanase Cel5a Catalytic Core Domain At 0.95 Angstroms Resolution [Salipaludibacillus agaradhaerens],8A3H_A Cellobiose-derived imidazole complex of the endoglucanase cel5A from Bacillus agaradhaerens at 0.97 A resolution [Salipaludibacillus agaradhaerens]
1H5V_A	3.12e-121	69	361	5	301	Thiopentasaccharidecomplex of the endoglucanase Cel5A from Bacillus agaradharens at 1.1 A resolution in the tetragonal crystal form [Salipaludibacillus agaradhaerens]
1E5J_A	3.23e-121	69	361	5	301	EndoglucanaseCel5a From Bacillus Agaradhaerens In The Tetragonal Crystal Form In Complex With Methyl-4ii-S-Alpha-Cellobiosyl-4ii-Thio Beta-Cellobioside [Salipaludibacillus agaradhaerens],1QHZ_A Native Tetragonal Structure Of The Endoglucanase Cel5a From Bacillus Agaradhaerens [Salipaludibacillus agaradhaerens],1QI0_A Endoglucanase Cel5a From Bacillus Agaradhaerens In The Tetragonal Crystal Form In Complex With Cellobiose [Salipaludibacillus agaradhaerens],1QI2_A Endoglucanase Cel5a From Bacillus Agaradhaerens In The Tetragonal Crystal Form In Complex With 2',4'-Dinitrophenyl 2-Deoxy-2-Fluoro-B- D-Cellotrioside [Salipaludibacillus agaradhaerens],2V38_A Family 5 endoglucanase Cel5A from Bacillus agaradhaerens in complex with cellobio-derived noeuromycin [Salipaludibacillus agaradhaerens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O85465	4.25e-119	69	361	31	327	Endoglucanase 5A OS=Salipaludibacillus agaradhaerens OX=76935 GN=cel5A PE=1 SV=1
P06565	4.60e-118	69	361	31	327	Endoglucanase B OS=Evansella cellulosilytica (strain ATCC 21833 / DSM 2522 / FERM P-1141 / JCM 9156 / N-4) OX=649639 GN=celB PE=3 SV=1
P07983	2.74e-117	70	361	36	330	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2
P10475	8.82e-116	70	360	36	329	Endoglucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=eglS PE=1 SV=1
P06566	3.26e-113	89	361	49	325	Endoglucanase A OS=Evansella cellulosilytica (strain ATCC 21833 / DSM 2522 / FERM P-1141 / JCM 9156 / N-4) OX=649639 GN=celA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.921858	0.052524	0.023734	0.000326	0.000170	0.001396

TMHMM  Annotations     

start	end
5	24