CAZyme Information: MGYG000000447_00208

Basic Information

• Species: CAG-484 sp900554385
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; CAG-484; CAG-484 sp900554385
• CAZyme ID: MGYG000000447_00208
• CAZy Family: CE11
• CAZyme Description: UDP-3-O-acyl-N-acetylglucosamine deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
271	MGYG000000447_1|CGC4	30528.19	7.3445

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000447	1931770	MAG	Sweden	Europe

• Gene Location: Start: 201112; End: 201927 Strand: -

Full Sequence      

MVTLKKETEITGNGLMKNKPCTVKFFPSNTGKIRYFVKGQDAFEANVDNVVSTEHCVVLG
NKKAQAMLTEHLTAALAFCGIDSLDICMDETEVPALDGSSRQWVELFKEAGIDKPFMYKP
QQYTVKEPVYYLNGKTSLVILPSEELFISYAVNYNHPDLTRRFVNYNPKNQDEIIEARTF
GFYKDLKKFQMFGFAQGVTVDNTVGLKDEGYTTELRSENEPAKHKILDLIGDLYLTGVNP
LNLKCQILAKEAGHAVHVKTAKILKDKLVKI

Enzyme Prediction     

No EC number prediction in MGYG000000447_00208.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE11	3	264	6.2e-67	0.981549815498155

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03331	LpxC	9.18e-75	3	266	3	271	UDP-3-O-acyl N-acetylglycosamine deacetylase. The enzymes in this family catalyze the second step in the biosynthetic pathway for lipid A.
PRK13186	lpxC	8.55e-72	3	267	6	276	UDP-3-O-acyl-N-acetylglucosamine deacetylase.
COG0774	LpxC	8.53e-61	3	267	6	279	UDP-3-O-acyl-N-acetylglucosamine deacetylase [Cell wall/membrane/envelope biogenesis].
PRK13188	PRK13188	1.51e-50	3	265	7	299	bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed
TIGR00325	lpxC	6.62e-48	3	267	5	274	UDP-3-0-acyl N-acetylglucosamine deacetylase. UDP-3-O-(R-3-hydroxymyristoyl)-GlcNAc deacetylase from E. coli , LpxC, was previously designated EnvA. This enzyme is involved in lipid-A precursor biosynthesis. It is essential for cell viability. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38878.1	1.80e-154	1	271	36	309
AGB42301.1	1.82e-44	3	269	7	275
AKE66309.1	4.46e-44	3	265	4	269
ARI84555.1	8.87e-44	3	265	4	269
QHU84659.1	8.87e-44	3	265	4	269

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3P3G_A	3.78e-28	3	259	6	270	CrystalStructure of the Escherichia coli LpxC/LPC-009 complex [Escherichia coli IHE3034],3PS1_A Crystal structure of the Escherichia Coli LPXC/LPC-011 complex [Escherichia coli IHE3034],3PS2_A Crystal structure of the Escherichia Coli LPXC/LPC-012 complex [Escherichia coli IHE3034],3PS3_A Crystal structure of the Escherichia Coli LPXC/LPC-053 complex [Escherichia coli IHE3034],4IS9_A Crystal Structure of the Escherichia coli LpxC/L-161,240 complex [Escherichia coli IHE3034],4IS9_B Crystal Structure of the Escherichia coli LpxC/L-161,240 complex [Escherichia coli IHE3034],4ISA_A Crystal Structure of the Escherichia coli LpxC/BB-78485 complex [Escherichia coli IHE3034]
4MDT_A	4.15e-28	3	259	6	270	Structureof LpxC bound to the reaction product UDP-(3-O-(R-3-hydroxymyristoyl))-glucosamine [Escherichia coli],4MDT_B Structure of LpxC bound to the reaction product UDP-(3-O-(R-3-hydroxymyristoyl))-glucosamine [Escherichia coli],4MDT_C Structure of LpxC bound to the reaction product UDP-(3-O-(R-3-hydroxymyristoyl))-glucosamine [Escherichia coli],4MDT_D Structure of LpxC bound to the reaction product UDP-(3-O-(R-3-hydroxymyristoyl))-glucosamine [Escherichia coli]
4MQY_A	4.15e-28	3	259	6	270	CrystalStructure of the Escherichia coli LpxC/LPC-138 complex [Escherichia coli]
3NZK_A	2.43e-27	3	259	11	275	Structureof LpxC from Yersinia enterocolitica Complexed with CHIR090 Inhibitor [Yersinia enterocolitica],3NZK_B Structure of LpxC from Yersinia enterocolitica Complexed with CHIR090 Inhibitor [Yersinia enterocolitica]
6IH0_A	5.04e-27	3	271	6	272	Aquifexaeolicus LpxC complex with ACHN-975 [Aquifex aeolicus VF5]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q72RV5	1.21e-42	3	268	9	278	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) OX=267671 GN=lpxC PE=3 SV=2
Q8F3U4	1.21e-42	3	268	9	278	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) OX=189518 GN=lpxC PE=3 SV=1
Q051J2	2.38e-42	3	268	9	278	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) OX=355276 GN=lpxC PE=3 SV=1
Q04T70	2.38e-42	3	268	9	278	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) OX=355277 GN=lpxC PE=3 SV=1
B0SS82	2.44e-42	3	268	9	279	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) OX=456481 GN=lpxC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000087	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000447_00208.