CAZyme Information: MGYG000000447_01609

Basic Information

• Species: CAG-484 sp900554385
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; CAG-484; CAG-484 sp900554385
• CAZyme ID: MGYG000000447_01609
• CAZy Family: GT2
• CAZyme Description: Beta-monoglucosyldiacylglycerol synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
465		54069.09	8.7995

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000447	1931770	MAG	Sweden	Europe

• Gene Location: Start: 35256; End: 36653 Strand: +

Full Sequence      

MKERVILFVIFFGLGVFLYIFQSYFNTVWGLAFLCLCMTIYALFTNLAYNLKKRKLRKYP
QVINEDYKPFISVMIPAHNEEDVIANTVENILQMDYENFEVIVIDDRSTDNTASVIKDLE
QKYPKVKALIRQQGAFPGKSAVLNDAFQMAHGDAVLVFDADATVEPDFLSKLVPELEPKD
VGAVQARKVIRNRSQNLLTRCQNNEYTMDTYFQAGRDSVKGAVELRGNGELIKREALEDI
GGWNNYTIVDDLDMSTRLHIRGWDVRYCIDAIVYEEGITYLWPLFRQRRRWLEGTIRRYL
EYSGEALTSKKMSMRAKLDMTAYISQFIMPLWFLMELTIRMFKVLAKDASPHMLFSSVII
GLVIGAGFFMAARYSLRRYDFMPRLDATFEALETSIYLFIIWFPLVFYIGFKILFMKKDM
NWGKTAHGLVKEEEASIKAFIKKELEKTKIYTEKLKQKLAEKGEK

Enzyme Prediction     

No EC number prediction in MGYG000000447_01609.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	69	292	3.1e-45	0.9869565217391304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1215	BcsA	7.63e-68	31	427	15	424	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	1.64e-58	73	251	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
PRK11204	PRK11204	6.73e-53	7	418	6	405	N-glycosyltransferase; Provisional
pfam13641	Glyco_tranf_2_3	2.68e-42	69	292	2	228	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd06439	CESA_like_1	4.70e-39	54	297	14	250	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38294.1	2.12e-240	46	463	2	423
BAZ42219.1	9.65e-74	55	427	95	465
AGY58232.1	2.51e-72	67	427	64	415
BAI89976.1	1.78e-70	60	427	161	546
QQW30928.1	1.78e-70	60	427	161	546

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	1.11e-13	57	300	116	380	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.17e-13	57	300	128	392	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.17e-13	57	300	129	393	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
5MLZ_A	4.82e-09	71	196	25	148	Dolichylphosphate mannose synthase in complex with GDP and Mg2+ [Pyrococcus furiosus DSM 3638],5MM0_A Dolichyl phosphate mannose synthase in complex with GDP-mannose and Mn2+ (donor complex) [Pyrococcus furiosus DSM 3638],5MM1_A Dolichyl phosphate mannose synthase in complex with GDP and dolichyl phosphate mannose [Pyrococcus furiosus DSM 3638]
1H7L_A	9.67e-09	69	184	1	121	dTDP-MAGNESIUMCOMPLEX OF SPSA FROM BACILLUS SUBTILIS [Bacillus subtilis],1H7Q_A dTDP-MANGANESE COMPLEX OF SPSA FROM BACILLUS SUBTILIS [Bacillus subtilis],1QG8_A Native (Magnesium-Containing) Spsa From Bacillus Subtilis [Bacillus subtilis],1QGQ_A Udp-manganese Complex Of Spsa From Bacillus Subtilis [Bacillus subtilis],1QGS_A Udp-Magnesium Complex Of Spsa From Bacillus Subtilis [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P74165	4.82e-64	69	438	108	477	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
Q8YMK0	1.51e-62	69	330	106	369	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1
Q3MB01	8.15e-62	69	330	106	369	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1
P96587	4.94e-30	69	294	49	279	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q8NUI7	3.26e-25	39	294	22	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000020	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	22
27	49
320	339
354	376
389	411