CAZyme Information: MGYG000000448_00078

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873
• CAZyme ID: MGYG000000448_00078
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
781		88266.12	5.6033

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000448	2372251	MAG	Sweden	Europe

• Gene Location: Start: 27278; End: 29623 Strand: -

Full Sequence      

MLCIPSVTSAQTRLYDNEFALSEVQLLESPFSHARDLNVETLLSYDTDRLLAPYMKAAGL
EPKGESFGNWDGLDGHIGGHYLSALAIHYAATGNPELKRRMDYMLSQLSMCAVARGDGYV
GGVPGGDELWNELRKGNAGRIWDWWVPWYNVHKMYAGLRDCWIYTGSQVARNLFLGICDW
GLGVIGALDDRQMESMLDNEFGGMNEVYADAYAMTGDSRYLDAARRFTHHQLFDDMRDGI
DNLDNRHANTQVPKVIGYQRVAELSGDDDYAKAAEFFWETVVNNRSLSIGGNSRREHFAS
AADAKSYVDDREGPESCNTNNMLKLTEGLFRMDHKARYADFYERALYNHILSTQHPAHGG
YVYFTSARPGHYRVYSQPNCAMWCCVGTGMENHGKYGQFIYTHTGSDSLQINLFIPSVLD
WQEKGVKVTQTTEYPAEGNTRLELTMDKPERLSLQLRHPDWCDAVTVKVNGKKISTHSTP
SSYITLDREWNNGDVVEMEMPMKVKLEELNYLPEYVSILRGPVVMAARYDNGAPLTGLVA
DDSRWGHIAGGPLVSVFDTPLLIGDRKDIVKKLNAMKPVDGQKMTFTVPGLFDGKYAGLV
LEPFFGIHDSRYMMYWLSMTPKEYKKYQANARRDEELRLALDRRTVDAVNTGEQQPEADH
FMDSRSSASGNFNGEPWRDASNGGYFSYRMKTDGASDLALRLRFWGNESGQRRFNILIDD
NILASENTAGKWNRNEFVEEEYHIPAELIKDKDFVTVKFAGEPGNTAGGIFHVRLIRPEA
K

Enzyme Prediction     

EC	3.2.1.185

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	23	526	3.9e-198	0.9980119284294234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	2.75e-176	23	526	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.82e-122	31	532	19	507	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	1.00e-35	535	616	5	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD43163.1	0.0	3	777	13	785
QCD36520.1	0.0	1	781	13	790
ADY37333.1	0.0	10	777	20	796
SCV06553.1	0.0	6	779	19	799
QRQ58640.1	0.0	6	779	19	799

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	2.29e-206	6	777	15	802	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	4.69e-200	6	777	15	802	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	1.98e-22	261	538	279	573	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	4.58e-22	212	605	203	609	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QK0_A	2.45e-21	261	538	279	573	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000028	0.000020	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000448_00078.