CAZyme Information: MGYG000000448_00171

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873
• CAZyme ID: MGYG000000448_00171
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
997	MGYG000000448_5|CGC1	108108.54	8.7809

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000448	2372251	MAG	Sweden	Europe

• Gene Location: Start: 8114; End: 11107 Strand: +

Full Sequence      

MKAHNYLKVIAAAALFFNLGVSAVTPNISRGREAEAARWADSVYASLTDRQRVAQLLVPM
VITQAGYEKAAAAVKRYVGTDGVGGLLFSEGSIEQYVRLCDLAQSEAKVPLLMTADGEWG
VAMRVKDTPRFPKNIVIGAVTDKRLVYDYGREVARQCKILGINTDFAPDADVNSNPANPV
IGSRSFGENPQRVAEAAVAFSLGMEDGGVQAVAKHFPGHGDTDGDSHKGPVTINHSRKVL
DDIDLVPFSKFIEAGCSGIMTGHLVVPALDPSQSPASLSSAVSAGFLRKVMGFEGLVFTD
ALEMKGAVAPDGKNNCVAALLAGADVLLVPKDVAVSVRELSRALADGTIPRATLEDRCKR
LLRYKYYLGLNRRKPLGTDYAAIARDLNSPEALALLRRLAAGAITVVKNEGGILPMGRLA
ERTFSVVSLGAPRDNEFAATCERYANATAFQNGGEAFSTSSLAKIEKGDVVIAAVFSDNA
AARQALAQLTAGPKPVVGVFMISPFRISKFGTSLNKLSAMMLGYEDIPDIRRCAAEAVFG
GIAVSGRLPVNIGSYYRAGAGINLPKTRLGFTSPVVEGFDANLTDSLDTLVKKGLETRAF
PGCQLLVARNGNIVYEKSFGKITGTPGAAPVNALTVYDLASVSKATGTLPGIMKAYDSGL
VSLDDSLGCLIPEITDSAKQHITVRELLYHETGMPAALNMYNVMFDSTSYTGRLITGRRD
RTHTIRIQNKAWGHNRARMRTDIIKRVRSDEFPVEASKGIFTGSSAYDTIMNRIYTIPLR
ANKDYNYSCLNFALLMDIEQRRTGIPHQNYVQTEIFGPLGAWRTGYRPLERFGSSEIAPT
EYDSYMRRQKVHGYVHDEMANFSGGVQGNAGLFANACDIAKICQMWLNGGIYGDARVLSP
ETVKLFTTAKSPTCRRGLGFDKPDTEHPDWSPTCDEASPEVYGHLGFTGTVFWVDPRENL
IFIFLTNRVDPTRDNAAFNRLSIRPRLFSQVYKAILR

Enzyme Prediction     

No EC number prediction in MGYG000000448_00171.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	103	329	2.5e-57	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	4.85e-76	47	415	1	349	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	4.01e-74	48	363	1	315	Glycosyl hydrolase family 3 N terminal domain.
PRK03642	PRK03642	3.22e-46	573	979	29	411	putative periplasmic esterase; Provisional
PRK05337	PRK05337	6.26e-40	83	339	26	291	beta-hexosaminidase; Provisional
pfam00144	Beta-lactamase	2.07e-34	587	977	1	317	Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD35538.1	0.0	21	995	22	989
ASB36988.1	1.93e-311	1	995	1	990
ANU62524.1	1.93e-311	1	995	1	990
QQR10146.1	1.93e-311	1	995	1	990
AHF12964.1	1.20e-285	15	995	14	987

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	6.37e-57	46	549	10	528	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	6.37e-56	59	415	67	446	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.88e-55	59	415	41	420	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	3.21e-55	59	415	71	450	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
3SQL_A	6.90e-50	46	365	14	346	CrystalStructure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQL_B Crystal Structure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQM_A Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_B Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_C Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_D Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	3.49e-55	59	415	67	446	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
Q8XBJ0	6.08e-41	572	968	28	395	Putative D-alanyl-D-alanine carboxypeptidase OS=Escherichia coli O157:H7 OX=83334 GN=yfeW PE=3 SV=1
P77619	1.11e-40	572	968	28	395	Putative D-alanyl-D-alanine carboxypeptidase OS=Escherichia coli (strain K12) OX=83333 GN=yfeW PE=1 SV=2
P48823	1.48e-40	84	416	66	425	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
L7N6B0	6.35e-35	45	365	57	380	Beta-hexosaminidase LpqI OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lpqI PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000360	0.998917	0.000218	0.000159	0.000152	0.000145

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000448_00171.