CAZyme Information: MGYG000000448_00844

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873
• CAZyme ID: MGYG000000448_00844
• CAZy Family: CE1
• CAZyme Description: Carbohydrate acetyl esterase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383	MGYG000000448_41|CGC1	42869.14	6.181

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000448	2372251	MAG	Sweden	Europe

• Gene Location: Start: 10149; End: 11300 Strand: +

Full Sequence      

MKKTTLSFLFSLTAAAAVAISPAEGIPASTNVPEAAYPCVDKDSKATFRIHAPRANDVKI
DICGRKYDMSRRSDGNWSVTTDPLVKGFHYYFVLVDGVAVNDPSSETFYGCGRQASGIEI
PESAEDAAFYTFNKDIPHGQVRECQYWSALEQQQRRCYVYTPAEYETSSDQTYPVLYLQH
GMGEDERGWHQQGKVANILDNQIAAGKCIPMIVVMDYGNCGYIHGARPGETRDQFGASFT
PVMLTELIPFIEKTFRVRTDRENRAMAGLSWGGHETFQITLHNLDKFAHIGSFSGALFFF
GNGLDNVCDGVFKDSETFNKRVHSLFLGMGSEENFGSDKISGMLSDAGIRHTYYVSPGTH
HEWLTWRRCLDRFLPLIFKGNND

Enzyme Prediction     

EC	3.1.1.72

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	151	375	2e-54	0.9559471365638766

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02858	E_set_Esterase_N	5.59e-39	45	121	2	78	N-terminal Early set domain associated with the catalytic domain of esterase. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
COG2382	Fes	1.31e-27	91	381	25	299	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
pfam00756	Esterase	8.68e-16	155	377	8	246	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2819	YbbA	9.18e-15	136	340	6	209	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].
cd11294	E_set_Esterase_like_N	2.93e-12	47	121	4	83	N-terminal Early set domain associated with the catalytic domain of putative esterases. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD43368.1	1.41e-211	1	383	1	385
QCD34663.1	5.08e-194	25	381	26	382
AVM57872.1	2.29e-142	27	379	292	644
AVM52697.1	7.35e-141	27	379	292	644
QIU93951.1	1.23e-140	27	379	285	637

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7B5V_A	1.62e-116	25	379	27	386	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6MOT_A	1.46e-113	22	379	3	359	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
6MOU_A	3.00e-113	22	379	24	380	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393],6MOU_B Chain B, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
6NE9_A	3.00e-94	27	379	31	382	ChainA, Isoamylase protein [Bacteroides intestinalis],6NE9_B Chain B, Isoamylase protein [Bacteroides intestinalis]
6RZO_A	3.76e-91	27	379	6	344	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EXZ4	7.48e-119	22	379	313	670	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
D5EY13	3.67e-67	26	379	383	726	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P31471	2.45e-35	15	379	23	389	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
P10478	2.28e-31	136	376	46	275	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
P9WM38	5.19e-08	159	295	192	319	Esterase MT1326 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1326 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000354	0.998975	0.000178	0.000174	0.000158	0.000151

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000448_00844.