CAZyme Information: MGYG000000448_01209

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873
• CAZyme ID: MGYG000000448_01209
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
264	MGYG000000448_74|CGC1	31153.66	9.596

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000448	2372251	MAG	Sweden	Europe

• Gene Location: Start: 5166; End: 5960 Strand: +

Full Sequence      

MVAVSIVTYHTEEGELRACLGSLDTEAVSRIYIVDNGSELRIEALTKEYPKTEYIASENV
GYGAAHNKAIRKSLADGTRYHLVLNSDVRFSPDVIARLLAVMDSRPEVAQLQPRIVYPDG
ELQYTVRRLPSPLDVFGRRFLPASWIRKRNDRYLLKALDHDRELNVPYHQGSFMLFRTEA
LRQVGLFDERFFMYPEDIDITRRMHRSFVTLYYPGETIVHDHRRESYRSWRLLRIHIVNM
IRYFNKWGWFSDKERVRVNRSLLP

Enzyme Prediction     

No EC number prediction in MGYG000000448_01209.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	6	184	3.2e-18	0.9764705882352941

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	7.35e-41	4	222	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.16e-39	1	255	4	259	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd02526	GT2_RfbF_like	5.89e-17	6	239	3	220	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.
COG1215	BcsA	3.33e-13	1	250	55	298	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam00535	Glycos_transf_2	2.51e-11	6	181	3	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABR40593.1	3.78e-112	1	263	1	263
QUT58341.1	3.78e-112	1	263	1	263
QQY37268.1	3.78e-112	1	263	1	263
QCD37025.1	7.84e-108	2	262	3	263
QGA24777.1	3.84e-95	1	263	1	263

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMY2	8.86e-18	22	226	26	240	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	8.86e-18	22	226	26	240	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2
P36667	4.60e-10	1	264	1	264	Rhamnosyltransferase WbbL OS=Escherichia coli (strain K12) OX=83333 GN=wbbL PE=1 SV=1
D4GU63	3.81e-09	2	211	20	213	Low-salt glycan biosynthesis hexosyltransferase Agl10 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=agl10 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000448_01209.