CAZyme Information: MGYG000000450_02086

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UMGS1826
• CAZyme ID: MGYG000000450_02086
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
702	MGYG000000450_67|CGC1	78756.29	4.9264

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000450	2671977	MAG	Sweden	Europe

• Gene Location: Start: 10128; End: 12236 Strand: +

Full Sequence      

MLQNAKWIAAANTADASPLFRKSFTLDQVPASAVLSACCLGYGVITVNGQPVTDDVLTTG
LTKFDASVLYNTYDVAALLRPGENVIGVMLGNGWYNDIAEVWDYEKAPWRHHPKMILSLE
MEWPDLTKREIRSDPTWTTCDGPAVYNHVRCGERFDARLVQKGFDCPGFDDSAWKNAFIC
RSPGGVLKPTEMPPIRVLDTLPMKEIAPGLYDCGQNLSGWAKIRVKGQPGQKISIRYDEL
VDPDGKLHGHVNSLNRSHELLHCDEYICAGGGWEEWEPHFCYHGFRYALVEGAPADFEIV
TRLVHTDLKSLGSFSCSDETLNRIHAASRWSTLTNYHSVPTDCPHREQNGWTGDALLSSE
QALMNFDMVEAYRKWMADFRDVQRPSGQLPGVVPTGGWGFNWGSGPAWDSAFILIPLYVW
RYRKDARLLEENWDAMERYMRYFDSMAMDYIADFGLGDWCPPETTVMCPSALTDTAYYYV
DACAMAEAAQVLDKDPAPYRALAGNIRRAFREKFVKNGLPQPEGQTAIACALYQGLLNED
EKPAAAARLAQLVEENGFHIGCGILGNKYIYRSLSDAGYGEVLYKMITNPTCPSYAYWLA
QGMTTLCENWEMTNSLNHHMFSEVDLWFYRYLAGIQTDGAVLTIAPLFLEELDWVKATHR
NISVSWNRETITVTVPEPAVLVLDGEKLLLEPGTSTFSRSGK

Enzyme Prediction     

No EC number prediction in MGYG000000450_02086.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	210	677	2.4e-137	0.9642857142857143
CBM67	5	184	1.6e-35	0.9715909090909091

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.45e-101	312	632	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.32e-49	30	197	3	170	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	7.07e-24	204	304	1	100	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	7.14e-04	643	698	13	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ94103.1	5.33e-220	17	661	143	808
AHF16194.1	8.79e-179	17	687	172	865
QNN24933.1	1.89e-175	17	640	352	996
AVM44981.1	1.82e-172	7	669	43	721
AYB33152.1	5.30e-169	18	669	185	856

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	5.12e-134	17	636	176	838	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	2.23e-93	7	676	292	985	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.17e-81	20	635	134	778	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	1.49e-97	16	638	183	846	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	1.01e-92	7	676	292	985	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	1.80e-87	21	678	178	869	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	5.51e-75	5	676	148	869	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.990773	0.009167	0.000056	0.000007	0.000006	0.000010

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000450_02086.