CAZyme Information: MGYG000000451_00018

Basic Information

• Species: UBA1820 sp002314265
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Flavobacteriales; UBA1820; UBA1820; UBA1820 sp002314265
• CAZyme ID: MGYG000000451_00018
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	MGYG000000451_1|CGC1	42676.48	9.6675

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000451	1842661	MAG	Sweden	Europe

• Gene Location: Start: 19627; End: 20766 Strand: -

Full Sequence      

MKYYIIAGEASGDLHGSNLVRALRNADPQARIRAWGGDLMQQAGAEVVKHYRDLAFMGFV
EVVANLRTILRNIRFCKQDIEAFAPDAVILVDYPGFNLRIAKWCRQKGYRTVYYISPQVW
AWKEGRVKAIRRNVDRMLVILPFEKDFYRRHHYPVEYVGHPLLDALARRSVPDPEAFRRE
EGLDGRPVVALLPGSRSQEIRAMLPVMARMAEVYPEYQFVVAATPVQPGELYDRLLASRP
IKRVTGRTYDLLSVAHAALVTSGTATLETALLGIPEVVCYKGSPVSYLIGRMVVKVPFIS
LVNLIAGREVVKELIQGAMNPRNLSRELGRILSGQAREKMLEDFASIRHLLGDGGASQRA
AEAIVGFLRQEEDQQTECR

Enzyme Prediction     

No EC number prediction in MGYG000000451_00018.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	351	1.6e-128	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	5.94e-143	1	372	2	379	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.08e-125	1	370	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	7.98e-94	4	363	2	370	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	9.11e-83	5	367	10	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	9.51e-59	52	357	46	338	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEE49237.1	7.68e-166	1	368	1	369
AXG73350.1	1.67e-164	1	369	1	370
QYJ69419.1	2.37e-164	1	369	1	370
AIP99513.1	1.80e-163	1	365	1	365
AFL96694.1	1.80e-163	1	365	1	365

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	9.52e-59	5	365	11	378	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.88e-58	5	365	11	378	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2LVL8	4.74e-92	5	370	8	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q74AT9	2.48e-89	2	368	8	380	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q1D393	6.11e-87	2	368	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q39T49	2.24e-84	2	368	8	380	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
B3E4H8	6.89e-83	2	370	8	382	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000451_00018.