CAZyme Information: MGYG000000452_01150

Basic Information

• Species: Barnesiella sp002159975
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Barnesiellaceae; Barnesiella; Barnesiella sp002159975
• CAZyme ID: MGYG000000452_01150
• CAZy Family: GH20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
832	MGYG000000452_29|CGC1	93265.32	5.9541

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000452	2678398	MAG	Sweden	Europe

• Gene Location: Start: 6204; End: 8702 Strand: -

Full Sequence      

MLMIMKKWILYSVATVSLWCSCTTSHKGEAPVALVWENGVYDASTQMYRHRFVVRNKTDR
ELAGDWEIFYSQLPVRVANDSTSPVCITAVNANYYKMAPTDRYRNIPPHDSLVVVYYADS
RAVNLSRQPEGCYWVAKGQNTPLPVELAIVPFSDRERMGDLSAEAIYRRNASYACPFDST
APAVLPSVKQAVAKGGRVSVPAEVSLLYNQELVDEARLLQEKLEQEYGIAVTEGASMHIE
LDLAAAGHTCNPEQYRLDIDNRQIAVVGATPHGVFNGIQTLLALLRGNSHTLDRQTIIDY
PDLSYRGFMLDVSRNFIPAADVKRWIDILSSYKIDVLHLHLTDDEGWRIEIPGLEELTAV
GGHRGHTTDESTCLYPGYDGSYSVTEGTGNGYYTRDEFVDLLRYAARRHVTVVPEVEAPG
HARAAIVAMKARYRKYAGTDEAKAREYLLSEPGDTSKYVSAQSYTDNVINVALPSTYAFM
EKVVTEIAAMYAEAGVALHTIHLGGDEVPEGAWLGSAACAKLMRDNRMEGPHDLFEYFYS
RMAGLVEAQGVKLAAWQEAALHNRATTDSRLKQVASNIYCWNTVPEWGGDEIPYRIANKG
YPVVLCNVNNFYMDLAYSSHYEERGHSWAGYVDEVKSFSMLPFSIYRSARCDLHDNPVDL
DRADEGKTRLDSLSKIVGVQAQLFSETVRGPQWAEYYIFPKILGLVERGWNAHPRWESLR
GEVEQQAFCQDVSRFYRQLDMQEYPYLIHSGVNVRLPHVGLCVIDGRLYANSPLSSAVIR
YTTDGSEPGTQSTVWRGPVVYPAGRVVKARLYYLGKESVTTVLFPTDTKSDK

Enzyme Prediction     

No EC number prediction in MGYG000000452_01150.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	304	712	2.6e-93	0.9554896142433235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06569	GH20_Sm-chitobiase-like	0.0	299	735	1	441	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
cd06563	GH20_chitobiase-like	8.93e-107	304	721	2	355	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
pfam00728	Glyco_hydro_20	5.09e-100	304	712	2	345	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
COG3525	Chb	3.62e-87	56	823	25	713	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd06568	GH20_SpHex_like	2.32e-68	304	723	2	329	A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex). SpHex catalyzes the hydrolysis of N-acetyl-beta-hexosaminides. An Asp residue within the active site plays a critical role in substrate-assisted catalysis by orienting the 2-acetamido group and stabilizing the transition state. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself. Proteins belonging to this subgroup lack the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL38883.1	1.98e-300	22	823	21	833
QDH57289.1	2.81e-300	22	823	21	833
CBK66445.1	2.52e-299	22	823	34	846
QUT80345.1	4.57e-299	22	823	21	833
QDM09388.1	6.48e-299	22	823	21	833

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QBA_A	5.16e-91	255	787	262	823	BACTERIALCHITOBIASE, GLYCOSYL HYDROLASE FAMILY 20 [Serratia marcescens],1QBB_A BACTERIAL CHITOBIASE COMPLEXED WITH CHITOBIOSE (DINAG) [Serratia marcescens]
1C7T_A	1.88e-89	255	787	262	823	ChainA, BETA-N-ACETYLHEXOSAMINIDASE [Serratia marcescens]
1C7S_A	9.59e-89	255	787	262	823	ChainA, BETA-N-ACETYLHEXOSAMINIDASE [Serratia marcescens]
6EZR_A	9.27e-65	249	757	205	640	Crystalstructure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZR_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZS_A Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6EZS_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6K35_A Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi],6K35_B Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi]
6EZT_A	1.12e-63	249	757	202	637	Crystalstructure of GH20 Exo beta-N-Acetylglucosaminidase D437A inactive mutant from Vibrio harveyi [Vibrio harveyi],6EZT_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase D437A inactive mutant from Vibrio harveyi [Vibrio harveyi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q04786	4.32e-100	93	785	123	809	Beta-hexosaminidase OS=Vibrio vulnificus OX=672 GN=hex PE=3 SV=1
Q54468	6.47e-90	255	787	289	850	Chitobiase OS=Serratia marcescens OX=615 GN=chb PE=1 SV=1
P49007	1.90e-88	52	717	60	732	Beta-hexosaminidase B OS=Pseudoalteromonas piscicida OX=43662 GN=nag096 PE=3 SV=1
P13670	2.19e-87	65	785	82	846	N,N'-diacetylchitobiase OS=Vibrio harveyi OX=669 GN=chb PE=1 SV=1
P96155	3.23e-60	249	709	204	604	Beta-hexosaminidase OS=Vibrio furnissii OX=29494 GN=exoI PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000049	0.005262	0.994707	0.000003	0.000004	0.000003

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000452_01150.