CAZyme Information: MGYG000000453_01030

Basic Information

• Species: Eubacterium_R sp900539775
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Eubacterium_R; Eubacterium_R sp900539775
• CAZyme ID: MGYG000000453_01030
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
817		93627.09	7.9802

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000453	1755797	MAG	Sweden	Europe

• Gene Location: Start: 43754; End: 46207 Strand: -

Full Sequence      

MERMSLAGKWILHLDKQDRDYETEVPTSDYNALLKNKIIDDPFYKTNEQKCLYVAETGKS
FKRSFKISQEQLEYRKALLRCQMLDTIAQIYINDKLANISSNAYICSETNITDYLHEGEN
SIEIHFLSPVQYVKAKQEEEPLPANANGINGVAHIRKPACHFGWDWGINMPVSGIFGNIE
ILFYNNEIRDFWVRQEHLENGTVKLHIRANKRLDGSGEITAPNGERIPFGIENGKAKVII
EKPQLWWTRELSGNESQPLYTIAIGSVKKRIGLRTIELDRSNDEYGADFKFILNGVPIFA
KGANVIPPDAMPDRIGKSTAEKIVSDAVHANFNMIRIWGGGYYGSDELYDLCDEKGILVW
QDFMFACLMYPFYDEAFIKNVLGEVKYNVRRISSHPSLALWCGNNEIEFMFQHLPASLKI
VKSYKEFFYEILPGELRRYDKNTPYIETSPIGSEFRKDITADKCGDTHMWHVWHGSKDLS
YYGKRYTRFCSEYGMESLPSEDCILQFATQKDMDLKSDVMLSHQKCKSGNDKMLFYLYEK
FNKPAKFTDLIYLTGLVQAECVANGAEHWRRNKGRCNGALWWQMNDCWGAPSWSSVDYFG
KWKPLMYAGKRIFEPITVSLRQTDGGFELYVLNDTLNDEEYTAVVSLKDFTGKELRSKSL
LVNSNAGKAQKAFFISAKGLKKSTCFAQAELRKNNKAVISRTAIMLPERKLKLQHAKITI
HLCKNEMTLESNTYARSVFVDIKGESVPLSDNCFDLVPGEKKTIYLEKDCKIDPKSISVK
CVNNITYAGSDAERIRFRKAFSAQPMNIANKIYYSIS

Enzyme Prediction     

EC	3.2.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	682	1.9e-88	0.699468085106383

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	4.25e-71	1	768	10	786	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	1.30e-12	724	784	14	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
PRK10340	ebgA	8.94e-09	30	409	90	452	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam17786	Mannosidase_ig	2.12e-07	625	701	1	81	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam00703	Glyco_hydro_2	1.12e-05	188	274	3	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUG59052.1	9.20e-184	4	777	3	802
BCJ98156.1	8.03e-179	1	756	1	791
QGH33887.1	2.21e-167	1	787	1	817
QUO31658.1	8.07e-167	1	768	1	797
ADL52891.1	2.60e-166	1	769	1	795

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	1.33e-132	2	766	7	816	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	1.40e-132	2	766	9	818	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	1.44e-132	2	766	9	818	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	3.77e-132	2	766	7	816	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	1.52e-130	2	766	7	816	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q95327	6.01e-99	4	655	23	730	Beta-mannosidase OS=Capra hircus OX=9925 GN=MANBA PE=1 SV=1
Q4FZV0	4.57e-96	5	765	24	857	Beta-mannosidase OS=Rattus norvegicus OX=10116 GN=Manba PE=2 SV=1
Q29444	8.48e-96	4	655	23	730	Beta-mannosidase OS=Bos taurus OX=9913 GN=MANBA PE=1 SV=1
Q8K2I4	6.09e-94	5	765	24	855	Beta-mannosidase OS=Mus musculus OX=10090 GN=Manba PE=1 SV=1
O00462	1.17e-93	5	654	24	729	Beta-mannosidase OS=Homo sapiens OX=9606 GN=MANBA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000453_01030.