CAZyme Information: MGYG000000455_00350

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; UBA1212; UBA1255; UMGS1537
• CAZyme ID: MGYG000000455_00350
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1147		127495.88	4.5772

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000455	1994916	MAG	Sweden	Europe

• Gene Location: Start: 5339; End: 8782 Strand: +

Full Sequence      

MKNTGRRFVRLIALCLMGAVWAVFLCAGCADKKEENGQQIIVPEELLPYRRITMTAKEDW
TASWIWAQNGETTPDTWVSFRKKFDVSDKNAAAGAIAHIAAESKYWLYINGEIVVREGGL
KRGPTPEDGYFDTVEIGNYLRDGENTIAALVWFWRDGVSYSSANSGKGGFLFEADWGDEK
LVSDATWLAVRNPAFLQDTGSRQPNYRLPEANVYYDARLELTDWEQPGYDDSGWEGAKEL
GKGGCAPWNTLYERPIPLLKDFGLKDYENSGAYADYTVSKKQSISMSVPYNAQLTPYLEV
ESEAGKEIVITTENTPQGSVFTTYVTKDGRQRFESPSWFNGEHITYTVPKGVKIISLKYR
ETGYNTEFSGSFTCSEDFMNTLWMKSLRTLYITMRDNFMDCPDRERAQWWGDVTNEMAMS
MYALDTNSYLLYQKGVAAMLAYTDPATKVLQTVVPIRGDYFELPMQQLAGVCGFWTYYLY
TGDAEFVQEVYRYAKDYVGLWTLGADGLVKHRAGSWDWADWGADFDIPTLENAWYYKALD
CVIRMAKLTGNEADIAELEQKAETVYGAYQSFWTKDGYRSPSVAVPDDRSNAMAVLSGLA
DPEKYETIRGNLTTVMHASPYMERYVLDALCEMGFMEDAQQRIRTRYQEMVEYDYSTLWE
FWDHGGTLNHAWSGGPLLTMSQYMAGVEPIEAGYTKFSVKPMPGSLTSLECTVPSVKGYI
TVAVRAEPNKSFRLSLQVPADTEAIAGIPRIGQAGANVRIEYLGSVVYENGAACVPEHLA
DRIAFSGSDDQFYYFSLQKQNASASHSFEAALGEAQDRSEYTVRLEVGENGAVLWDGERL
ESGSHVKAVRRGAEISLEAVPDSGAYFSGWSGAAGSRNKTVSLRPQCDLEIRAEFIKKQS
AFRSVTFLADAGCDITLQTDGGRKISLAQGTSTVLLKDGETVRFTVRDGFLYRFAAFQGD
AVSTEPQITVTPDRDLEIRVAAEKLPAVNIALGAKASAGDSLENGDWGVSYLTDGSLKKG
YTTNVLKPDTDGKIKPVTVTLDLGGEKQFRHIAFAPRTDVTDPAGGSPNYPTEFTVSVSS
DGKNYTAVETFRGEENPMGATQTYDLGIQRAAYVKIDFTRAGTFASDEGVADPYRIQLME
IFLYAGA

Enzyme Prediction     

No EC number prediction in MGYG000000455_00350.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	304	744	8.3e-86	0.9047619047619048
CBM67	62	248	8e-42	0.9943181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.21e-29	367	684	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	3.18e-12	105	240	16	153	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	1.13e-08	686	750	1	65	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam00754	F5_F8_type_C	8.97e-08	994	1123	2	117	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
COG3408	GDB1	3.65e-04	477	609	351	504	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEV28934.1	1.84e-228	47	1141	27	1117
AXE90460.1	2.45e-225	60	1141	40	1117
QJT00118.1	3.45e-225	46	1141	26	1117
QTU58279.1	3.45e-225	46	1141	26	1117
ADL35844.1	3.50e-224	65	762	7	705

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	2.41e-25	56	261	2	200	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
6GSZ_A	9.53e-14	58	775	109	868	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	6.91e-15	59	749	148	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
T2KM26	9.08e-12	367	744	728	1132	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000001	0.000011	1.000039	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	24