CAZyme Information: MGYG000000455_00388

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; UBA1212; UBA1255; UMGS1537
• CAZyme ID: MGYG000000455_00388
• CAZy Family: GH63
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
505	MGYG000000455_38|CGC1	58248.83	6.1079

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000455	1994916	MAG	Sweden	Europe

• Gene Location: Start: 1283; End: 2800 Strand: +

Full Sequence      

MGNLYKVNESLFYAENEYAGKNPFLHMTPENNPLPDYEKIKCKLPQPLWEGHTDAVACYY
KAWEIAFRNLRTPNAEAGFVSNFIDTAFNGYLFMWDSSFIVMFGRYASHIFNFQKTLDNF
YSHQHRDGFICREICEAQNGEQFHRDDPASTGPNIMPWSEWEYYQITGDKARLEKIFYPL
LAYHKWLQLNHTWRDGSYWSTGLACGMDNQPRVQNGYSHLTSHGHAIWLDTCIHMVMSGK
ILVEIGKITGHEEDTAWLREEIARLTKLINEKLWCEEDAFYYDLWKGDVPSKVKSIGAYW
ALLAEIVPESRLERFIAHLENPAEFKRPHRVPTLSADHPAYQKDGGYWLGSVWAPTNYMV
LKGLEKNGYQKLAFEIAENHLGNVVEVFRKTGTVWENYSPEEAAPGNPAKSDFVGWTGLV
PIAVLFEYVFGIRADSRNHVITWDVNLTEKHGVLQYPFNGAFLDLICDERAGKEREPQVK
VRSDTPVKVLVRWDGGEKTIESTRA

Enzyme Prediction     

No EC number prediction in MGYG000000455_00388.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	61	416	3.6e-37	0.4052631578947368

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3408	GDB1	8.33e-20	94	466	290	641	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
PRK10137	PRK10137	3.05e-17	151	404	417	762	alpha-glucosidase; Provisional
pfam03200	Glyco_hydro_63	8.24e-14	173	420	188	488	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
pfam01204	Trehalase	5.69e-12	240	428	316	508	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
pfam17389	Bac_rhamnosid6H	1.11e-08	155	320	105	252	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ57834.1	4.64e-209	13	501	7	496
QIN83484.1	1.59e-207	13	501	11	508
QHT63246.1	1.67e-203	13	500	30	521
QHT63247.1	1.47e-194	13	500	28	519
BAX79981.1	1.38e-183	4	501	34	531

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MHF_A	4.68e-10	93	439	390	790	Murineendoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]
3W7S_A	7.36e-09	150	400	389	731	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	7.36e-09	150	400	389	731	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
6XUX_A	1.37e-08	229	400	100	280	ChainA, Nanobody,Glucosidase YgjK,Glucosidase YgjK,Nanobody [Escherichia coli K-12]
7PQQ_B	1.37e-08	229	400	100	280	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94250	3.68e-36	97	484	62	443	Uncharacterized protein BB_0381 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0381 PE=4 SV=2
O14255	4.58e-13	134	420	518	800	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
Q80UM7	2.83e-10	93	428	445	834	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
Q19426	8.44e-10	153	420	490	786	Mannosyl-oligosaccharide glucosidase OS=Caenorhabditis elegans OX=6239 GN=mogs-1 PE=1 SV=2
O88941	1.98e-09	93	428	445	834	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000025	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000455_00388.